BLASTX nr result
ID: Rehmannia22_contig00033984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00033984 (406 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY27238.1| Ubiquitin-like superfamily protein isoform 4, par... 59 5e-07 ref|XP_006361340.1| PREDICTED: ubiquitin-like protein ATG12-like... 59 9e-07 ref|XP_004252395.1| PREDICTED: ubiquitin-like protein ATG12-like... 59 9e-07 gb|EOY27237.1| Ubiquitin-like superfamily protein isoform 3 [The... 57 2e-06 gb|EOY27236.1| Ubiquitin-like superfamily protein isoform 2, par... 57 2e-06 gb|EOY27235.1| Ubiquitin-like superfamily protein isoform 1 [The... 57 2e-06 ref|XP_004510461.1| PREDICTED: ubiquitin-like protein ATG12-like... 57 2e-06 ref|XP_004303685.1| PREDICTED: ubiquitin-like protein ATG12-like... 57 2e-06 gb|EMJ17907.1| hypothetical protein PRUPE_ppa026527mg, partial [... 57 2e-06 ref|XP_002275073.1| PREDICTED: ubiquitin-like isoform 1 [Vitis v... 57 2e-06 gb|ESW07440.1| hypothetical protein PHAVU_010G130300g [Phaseolus... 57 2e-06 gb|AFW73721.1| hypothetical protein ZEAMMB73_378775 [Zea mays] 57 2e-06 gb|AFK36843.1| unknown [Lotus japonicus] 57 2e-06 gb|ADY38660.1| putative autophagy-related protein 12 [Wolffia ar... 57 2e-06 ref|NP_001235450.1| uncharacterized protein LOC100527905 [Glycin... 57 2e-06 ref|XP_003627265.1| Autophagy-like protein [Medicago truncatula]... 57 2e-06 gb|EXC24921.1| Ubiquitin-like protein ATG12 [Morus notabilis] 57 3e-06 ref|XP_006849646.1| hypothetical protein AMTR_s00024p00226010 [A... 57 3e-06 ref|NP_001236589.1| uncharacterized protein LOC100527733 [Glycin... 57 3e-06 ref|XP_003570522.1| PREDICTED: ubiquitin-like protein ATG12-like... 56 6e-06 >gb|EOY27238.1| Ubiquitin-like superfamily protein isoform 4, partial [Theobroma cacao] Length = 90 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYNVSCQFMISS 297 LHR+TLFVYVNSAFSPNPDELV+DLYN+ + +S Sbjct: 47 LHRDTLFVYVNSAFSPNPDELVIDLYNILTSYFHTS 82 >ref|XP_006361340.1| PREDICTED: ubiquitin-like protein ATG12-like [Solanum tuberosum] Length = 90 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHRETLFVYVNSAFSPNPDELV+DLYN Sbjct: 45 LHRETLFVYVNSAFSPNPDELVIDLYN 71 >ref|XP_004252395.1| PREDICTED: ubiquitin-like protein ATG12-like [Solanum lycopersicum] Length = 90 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHRETLFVYVNSAFSPNPDELV+DLYN Sbjct: 45 LHRETLFVYVNSAFSPNPDELVIDLYN 71 >gb|EOY27237.1| Ubiquitin-like superfamily protein isoform 3 [Theobroma cacao] Length = 108 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHR+TLFVYVNSAFSPNPDELV+DLYN Sbjct: 49 LHRDTLFVYVNSAFSPNPDELVIDLYN 75 >gb|EOY27236.1| Ubiquitin-like superfamily protein isoform 2, partial [Theobroma cacao] Length = 114 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHR+TLFVYVNSAFSPNPDELV+DLYN Sbjct: 69 LHRDTLFVYVNSAFSPNPDELVIDLYN 95 >gb|EOY27235.1| Ubiquitin-like superfamily protein isoform 1 [Theobroma cacao] Length = 94 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHR+TLFVYVNSAFSPNPDELV+DLYN Sbjct: 49 LHRDTLFVYVNSAFSPNPDELVIDLYN 75 >ref|XP_004510461.1| PREDICTED: ubiquitin-like protein ATG12-like [Cicer arietinum] Length = 94 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHR+TLFVYVNSAFSPNPDELV+DLYN Sbjct: 49 LHRDTLFVYVNSAFSPNPDELVIDLYN 75 >ref|XP_004303685.1| PREDICTED: ubiquitin-like protein ATG12-like [Fragaria vesca subsp. vesca] Length = 95 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHR+TLFVYVNSAFSPNPDELV+DLYN Sbjct: 50 LHRDTLFVYVNSAFSPNPDELVMDLYN 76 >gb|EMJ17907.1| hypothetical protein PRUPE_ppa026527mg, partial [Prunus persica] Length = 82 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHR+TLFVYVNSAFSPNPDELV+DLYN Sbjct: 37 LHRDTLFVYVNSAFSPNPDELVIDLYN 63 >ref|XP_002275073.1| PREDICTED: ubiquitin-like isoform 1 [Vitis vinifera] gi|359482638|ref|XP_003632796.1| PREDICTED: ubiquitin-like isoform 2 [Vitis vinifera] gi|297743012|emb|CBI35879.3| unnamed protein product [Vitis vinifera] Length = 94 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHR+TLFVYVNSAFSPNPDELV+DLYN Sbjct: 49 LHRDTLFVYVNSAFSPNPDELVIDLYN 75 >gb|ESW07440.1| hypothetical protein PHAVU_010G130300g [Phaseolus vulgaris] Length = 94 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHRETLFVYVNSAFSPNPDELV+DL+N Sbjct: 49 LHRETLFVYVNSAFSPNPDELVIDLFN 75 >gb|AFW73721.1| hypothetical protein ZEAMMB73_378775 [Zea mays] Length = 75 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYNV 321 LH++TLFVY+NSAFSPNPDELV+DLYNV Sbjct: 46 LHQDTLFVYINSAFSPNPDELVIDLYNV 73 >gb|AFK36843.1| unknown [Lotus japonicus] Length = 94 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHR+TLFVYVNSAFSPNPDEL++DLYN Sbjct: 49 LHRDTLFVYVNSAFSPNPDELIIDLYN 75 >gb|ADY38660.1| putative autophagy-related protein 12 [Wolffia arrhiza] Length = 98 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHR+TLFVY+NSAFSPNPDELV+DLYN Sbjct: 53 LHRDTLFVYINSAFSPNPDELVIDLYN 79 >ref|NP_001235450.1| uncharacterized protein LOC100527905 [Glycine max] gi|255633518|gb|ACU17117.1| unknown [Glycine max] Length = 94 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHRETLFVYVNSAFSPNPDELV+DL+N Sbjct: 49 LHRETLFVYVNSAFSPNPDELVIDLFN 75 >ref|XP_003627265.1| Autophagy-like protein [Medicago truncatula] gi|122187475|sp|Q1SF86.1|ATG12_MEDTR RecName: Full=Ubiquitin-like protein ATG12; AltName: Full=Autophagy-related protein 12; Short=APG12-like gi|355521287|gb|AET01741.1| Autophagy-like protein [Medicago truncatula] Length = 95 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHRE+LFVYVNSAFSPNPDELV+DLYN Sbjct: 50 LHRESLFVYVNSAFSPNPDELVIDLYN 76 >gb|EXC24921.1| Ubiquitin-like protein ATG12 [Morus notabilis] Length = 79 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYNV 321 LHR+TLFVYVNSAFSPNPDE V+DLYNV Sbjct: 50 LHRDTLFVYVNSAFSPNPDESVIDLYNV 77 >ref|XP_006849646.1| hypothetical protein AMTR_s00024p00226010 [Amborella trichopoda] gi|548853221|gb|ERN11227.1| hypothetical protein AMTR_s00024p00226010 [Amborella trichopoda] Length = 94 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHRETLFVYVNSAFSPNPDELV+DLY+ Sbjct: 49 LHRETLFVYVNSAFSPNPDELVIDLYD 75 >ref|NP_001236589.1| uncharacterized protein LOC100527733 [Glycine max] gi|255633072|gb|ACU16891.1| unknown [Glycine max] Length = 94 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYN 324 LHRETLFVY+NSAFSPNPDELV+DL+N Sbjct: 49 LHRETLFVYINSAFSPNPDELVIDLFN 75 >ref|XP_003570522.1| PREDICTED: ubiquitin-like protein ATG12-like [Brachypodium distachyon] Length = 95 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/48 (56%), Positives = 31/48 (64%) Frame = -3 Query: 404 LHRETLFVYVNSAFSPNPDELVLDLYNVSCQFMISS*TWENQVFGVGW 261 LH++TLFVY+NSAFSPNPDELV+DLYN F I N W Sbjct: 50 LHQDTLFVYINSAFSPNPDELVIDLYN---NFAIDGKLVVNYALSAAW 94