BLASTX nr result
ID: Rehmannia22_contig00033943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00033943 (712 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB50259.1| Aspartic proteinase nepenthesin-2 [Morus notabilis] 57 8e-06 >gb|EXB50259.1| Aspartic proteinase nepenthesin-2 [Morus notabilis] Length = 463 Score = 56.6 bits (135), Expect = 8e-06 Identities = 37/83 (44%), Positives = 49/83 (59%), Gaps = 8/83 (9%) Frame = +2 Query: 167 MFLHV--LLTVFQ------AAASKSTGFTLKLIPWDSPNSPLYQPNLNQTQKIHIMAMSS 322 + LHV +LT+FQ + +SK +GF+LKLIP DSP SPLY NL QTQ++ + S Sbjct: 10 LVLHVTLVLTIFQTHDFRFSYSSKPSGFSLKLIPRDSPESPLYPGNLTQTQRVERLIKFS 69 Query: 323 KARAVSSTPKNETFYANAIQIPE 391 ARA N Y+ A+ PE Sbjct: 70 NARA------NYLKYSAALTKPE 86