BLASTX nr result
ID: Rehmannia22_contig00033491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00033491 (521 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006484370.1| PREDICTED: uncharacterized protein LOC102610... 68 1e-09 ref|XP_006484369.1| PREDICTED: uncharacterized protein LOC102610... 68 1e-09 ref|XP_006484368.1| PREDICTED: uncharacterized protein LOC102610... 68 1e-09 ref|XP_006437783.1| hypothetical protein CICLE_v10032286mg [Citr... 68 1e-09 ref|XP_006844190.1| hypothetical protein AMTR_s00006p00263990 [A... 67 2e-09 ref|XP_002514531.1| conserved hypothetical protein [Ricinus comm... 65 9e-09 ref|XP_003631234.1| PREDICTED: uncharacterized protein LOC100256... 65 1e-08 emb|CBI27125.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002311406.1| hypothetical protein POPTR_0008s10910g [Popu... 65 1e-08 ref|XP_002279949.1| PREDICTED: uncharacterized protein LOC100256... 65 1e-08 ref|XP_006415902.1| hypothetical protein EUTSA_v10008392mg [Eutr... 64 2e-08 ref|NP_001046704.1| Os02g0326000 [Oryza sativa Japonica Group] g... 63 4e-08 gb|EEC73053.1| hypothetical protein OsI_07007 [Oryza sativa Indi... 63 4e-08 ref|XP_006305377.1| hypothetical protein CARUB_v10009768mg, part... 63 5e-08 gb|EMJ28722.1| hypothetical protein PRUPE_ppa011886mg [Prunus pe... 63 5e-08 gb|AAG50677.1|AC079829_10 unknown protein [Arabidopsis thaliana] 63 5e-08 ref|XP_003571222.1| PREDICTED: uncharacterized protein LOC100830... 63 5e-08 ref|XP_002893413.1| hypothetical protein ARALYDRAFT_890129 [Arab... 63 5e-08 ref|NP_173943.2| uncharacterized protein [Arabidopsis thaliana] ... 63 5e-08 ref|XP_004160832.1| PREDICTED: uncharacterized LOC101204847 [Cuc... 62 6e-08 >ref|XP_006484370.1| PREDICTED: uncharacterized protein LOC102610092 isoform X3 [Citrus sinensis] Length = 264 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLN GFFVFLLHLLY+VF TRLG+KASLRLP+WLE A+ Sbjct: 227 LLNSGFFVFLLHLLYSVFLTRLGMKASLRLPRWLEMAL 264 >ref|XP_006484369.1| PREDICTED: uncharacterized protein LOC102610092 isoform X2 [Citrus sinensis] Length = 280 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLN GFFVFLLHLLY+VF TRLG+KASLRLP+WLE A+ Sbjct: 243 LLNSGFFVFLLHLLYSVFLTRLGMKASLRLPRWLEMAL 280 >ref|XP_006484368.1| PREDICTED: uncharacterized protein LOC102610092 isoform X1 [Citrus sinensis] Length = 291 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLN GFFVFLLHLLY+VF TRLG+KASLRLP+WLE A+ Sbjct: 254 LLNSGFFVFLLHLLYSVFLTRLGMKASLRLPRWLEMAL 291 >ref|XP_006437783.1| hypothetical protein CICLE_v10032286mg [Citrus clementina] gi|557539979|gb|ESR51023.1| hypothetical protein CICLE_v10032286mg [Citrus clementina] Length = 291 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLN GFFVFLLHLLY+VF TRLG+KASLRLP+WLE A+ Sbjct: 254 LLNSGFFVFLLHLLYSVFLTRLGMKASLRLPRWLEMAL 291 >ref|XP_006844190.1| hypothetical protein AMTR_s00006p00263990 [Amborella trichopoda] gi|548846589|gb|ERN05865.1| hypothetical protein AMTR_s00006p00263990 [Amborella trichopoda] Length = 294 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLNCGFFVFLLH+LYAVF +RLG+K SL LP+WLE AI Sbjct: 257 LLNCGFFVFLLHVLYAVFLSRLGMKVSLSLPRWLEKAI 294 >ref|XP_002514531.1| conserved hypothetical protein [Ricinus communis] gi|223546135|gb|EEF47637.1| conserved hypothetical protein [Ricinus communis] Length = 306 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLN G FVFLLHLLY+VFFTRLG+K SLRLP+WLE A+ Sbjct: 268 LLNSGSFVFLLHLLYSVFFTRLGMKDSLRLPRWLEKAL 305 >ref|XP_003631234.1| PREDICTED: uncharacterized protein LOC100256033 isoform 2 [Vitis vinifera] Length = 140 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLN GFFVFLLH+LYAVF +RLG+KASL +P+WLE AI Sbjct: 103 LLNSGFFVFLLHILYAVFLSRLGMKASLTMPRWLEKAI 140 >emb|CBI27125.3| unnamed protein product [Vitis vinifera] Length = 192 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLN GFFVFLLH+LYAVF +RLG+KASL +P+WLE AI Sbjct: 155 LLNSGFFVFLLHILYAVFLSRLGMKASLTMPRWLEKAI 192 >ref|XP_002311406.1| hypothetical protein POPTR_0008s10910g [Populus trichocarpa] gi|222851226|gb|EEE88773.1| hypothetical protein POPTR_0008s10910g [Populus trichocarpa] Length = 306 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 +LN GFFVFLLHLLY+VF TRLG+K SLRLP+WLE A+ Sbjct: 269 VLNSGFFVFLLHLLYSVFLTRLGMKDSLRLPRWLEKAL 306 >ref|XP_002279949.1| PREDICTED: uncharacterized protein LOC100256033 isoform 1 [Vitis vinifera] Length = 286 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLN GFFVFLLH+LYAVF +RLG+KASL +P+WLE AI Sbjct: 249 LLNSGFFVFLLHILYAVFLSRLGMKASLTMPRWLEKAI 286 >ref|XP_006415902.1| hypothetical protein EUTSA_v10008392mg [Eutrema salsugineum] gi|557093673|gb|ESQ34255.1| hypothetical protein EUTSA_v10008392mg [Eutrema salsugineum] Length = 287 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLN GFFV LLHLLY+VF TRLG+K+SLRLP WLE AI Sbjct: 250 LLNSGFFVLLLHLLYSVFLTRLGMKSSLRLPAWLEKAI 287 >ref|NP_001046704.1| Os02g0326000 [Oryza sativa Japonica Group] gi|46390264|dbj|BAD15693.1| unknown protein [Oryza sativa Japonica Group] gi|113536235|dbj|BAF08618.1| Os02g0326000 [Oryza sativa Japonica Group] gi|215736884|dbj|BAG95813.1| unnamed protein product [Oryza sativa Japonica Group] gi|215765527|dbj|BAG87224.1| unnamed protein product [Oryza sativa Japonica Group] gi|222622737|gb|EEE56869.1| hypothetical protein OsJ_06502 [Oryza sativa Japonica Group] Length = 281 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLNCGFF+FLLH++Y +F T+LG+K SLR P+WL+ AI Sbjct: 244 LLNCGFFIFLLHIMYTIFLTKLGIKPSLRPPRWLDKAI 281 >gb|EEC73053.1| hypothetical protein OsI_07007 [Oryza sativa Indica Group] Length = 281 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLNCGFF+FLLH++Y +F T+LG+K SLR P+WL+ AI Sbjct: 244 LLNCGFFIFLLHIMYTIFLTKLGIKPSLRPPRWLDKAI 281 >ref|XP_006305377.1| hypothetical protein CARUB_v10009768mg, partial [Capsella rubella] gi|482574088|gb|EOA38275.1| hypothetical protein CARUB_v10009768mg, partial [Capsella rubella] Length = 320 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLN GFFV LLHLLY++F TRLG+K+SLRLP WL+ AI Sbjct: 283 LLNSGFFVLLLHLLYSIFLTRLGMKSSLRLPAWLDKAI 320 >gb|EMJ28722.1| hypothetical protein PRUPE_ppa011886mg [Prunus persica] Length = 192 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 L+N G F+FLLHLLY+VF TRLG+K+SLRLP+WLE AI Sbjct: 155 LINSGSFMFLLHLLYSVFLTRLGMKSSLRLPRWLEKAI 192 >gb|AAG50677.1|AC079829_10 unknown protein [Arabidopsis thaliana] Length = 275 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLN GFFV LLHLLY++F TRLG+K+SLRLP WL+ AI Sbjct: 238 LLNSGFFVLLLHLLYSIFLTRLGMKSSLRLPAWLDKAI 275 >ref|XP_003571222.1| PREDICTED: uncharacterized protein LOC100830022 [Brachypodium distachyon] Length = 295 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLE 105 LLNCGFFVF+LH++Y +F T+LG+K SLRLP+WL+ Sbjct: 239 LLNCGFFVFILHIIYTIFLTKLGIKPSLRLPRWLD 273 >ref|XP_002893413.1| hypothetical protein ARALYDRAFT_890129 [Arabidopsis lyrata subsp. lyrata] gi|297339255|gb|EFH69672.1| hypothetical protein ARALYDRAFT_890129 [Arabidopsis lyrata subsp. lyrata] Length = 293 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLN GFFV LLHLLY++F TRLG+K+SLRLP WL+ AI Sbjct: 256 LLNSGFFVLLLHLLYSIFLTRLGMKSSLRLPAWLDKAI 293 >ref|NP_173943.2| uncharacterized protein [Arabidopsis thaliana] gi|18252157|gb|AAL61911.1| unknown protein [Arabidopsis thaliana] gi|21386935|gb|AAM47871.1| unknown protein [Arabidopsis thaliana] gi|332192537|gb|AEE30658.1| uncharacterized protein AT1G26180 [Arabidopsis thaliana] Length = 289 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +1 Query: 1 LLNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LLN GFFV LLHLLY++F TRLG+K+SLRLP WL+ AI Sbjct: 252 LLNSGFFVLLLHLLYSIFLTRLGMKSSLRLPAWLDKAI 289 >ref|XP_004160832.1| PREDICTED: uncharacterized LOC101204847 [Cucumis sativus] Length = 469 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 4 LNCGFFVFLLHLLYAVFFTRLGLKASLRLPKWLEAAI 114 LNCG F+FLLHLLY++F TRLGLK SL LP+WLE A+ Sbjct: 433 LNCGCFMFLLHLLYSIFLTRLGLKTSLTLPRWLEKAM 469