BLASTX nr result
ID: Rehmannia22_contig00033419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00033419 (391 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002978078.1| hypothetical protein SELMODRAFT_108361 [Sela... 59 7e-07 gb|EMT05042.1| AP2-like ethylene-responsive transcription factor... 59 9e-07 gb|AAT44955.1| putative AP2/EREBP transcription factor [Arabidop... 57 2e-06 emb|CAB81797.1| aintegumaenta-like protein [Arabidopsis thaliana] 57 2e-06 gb|EXC32624.1| Ethylene-responsive transcription factor WRI1 [Mo... 57 3e-06 gb|EXB63821.1| Ethylene-responsive transcription factor WRI1 [Mo... 57 3e-06 ref|XP_006602898.1| PREDICTED: ethylene-responsive transcription... 57 3e-06 ref|XP_006587765.1| PREDICTED: ethylene-responsive transcription... 57 3e-06 ref|XP_006482670.1| PREDICTED: AP2-like ethylene-responsive tran... 57 3e-06 ref|XP_006365981.1| PREDICTED: AP2-like ethylene-responsive tran... 57 3e-06 gb|ESW25833.1| hypothetical protein PHAVU_003G069000g [Phaseolus... 57 3e-06 gb|ESW25832.1| hypothetical protein PHAVU_003G069000g [Phaseolus... 57 3e-06 ref|XP_006431090.1| hypothetical protein CICLE_v10013824mg [Citr... 57 3e-06 ref|XP_002315794.2| hypothetical protein POPTR_0010s10290g [Popu... 57 3e-06 ref|XP_006836147.1| hypothetical protein AMTR_s00101p00022740 [A... 57 3e-06 ref|XP_006829312.1| hypothetical protein AMTR_s00202p00017170 [A... 57 3e-06 gb|EOY03384.1| Integrase-type DNA-binding superfamily protein [T... 57 3e-06 ref|XP_004489378.1| PREDICTED: ethylene-responsive transcription... 57 3e-06 ref|XP_004489178.1| PREDICTED: AP2-like ethylene-responsive tran... 57 3e-06 gb|EMT25061.1| Ethylene-responsive transcription factor WRI1 [Ae... 57 3e-06 >ref|XP_002978078.1| hypothetical protein SELMODRAFT_108361 [Selaginella moellendorffii] gi|300154099|gb|EFJ20735.1| hypothetical protein SELMODRAFT_108361 [Selaginella moellendorffii] Length = 203 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYSK 315 HNGRWEARIGRVFGNKYLYLGTYSK Sbjct: 152 HNGRWEARIGRVFGNKYLYLGTYSK 176 >gb|EMT05042.1| AP2-like ethylene-responsive transcription factor [Aegilops tauschii] Length = 117 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYSK*SN 306 HNGRWEARIGRVFGNKYLYLGTY+K N Sbjct: 86 HNGRWEARIGRVFGNKYLYLGTYAKPQN 113 >gb|AAT44955.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana] Length = 208 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYSK*SNY*PF 294 HNGRWEARIGRVFGNKYLYLGTYS S + PF Sbjct: 176 HNGRWEARIGRVFGNKYLYLGTYSTLSPF-PF 206 >emb|CAB81797.1| aintegumaenta-like protein [Arabidopsis thaliana] Length = 205 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYSK*SNY*PF 294 HNGRWEARIGRVFGNKYLYLGTYS S + PF Sbjct: 173 HNGRWEARIGRVFGNKYLYLGTYSTLSPF-PF 203 >gb|EXC32624.1| Ethylene-responsive transcription factor WRI1 [Morus notabilis] Length = 399 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 186 HNGRWEARIGRVFGNKYLYLGTYS 209 >gb|EXB63821.1| Ethylene-responsive transcription factor WRI1 [Morus notabilis] Length = 412 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 182 HNGRWEARIGRVFGNKYLYLGTYS 205 >ref|XP_006602898.1| PREDICTED: ethylene-responsive transcription factor WRI1-like [Glycine max] Length = 392 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 183 HNGRWEARIGRVFGNKYLYLGTYS 206 >ref|XP_006587765.1| PREDICTED: ethylene-responsive transcription factor WRI1-like [Glycine max] Length = 392 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 183 HNGRWEARIGRVFGNKYLYLGTYS 206 >ref|XP_006482670.1| PREDICTED: AP2-like ethylene-responsive transcription factor At1g16060-like [Citrus sinensis] Length = 391 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 180 HNGRWEARIGRVFGNKYLYLGTYS 203 >ref|XP_006365981.1| PREDICTED: AP2-like ethylene-responsive transcription factor At1g16060-like [Solanum tuberosum] Length = 405 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 193 HNGRWEARIGRVFGNKYLYLGTYS 216 >gb|ESW25833.1| hypothetical protein PHAVU_003G069000g [Phaseolus vulgaris] Length = 404 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 181 HNGRWEARIGRVFGNKYLYLGTYS 204 >gb|ESW25832.1| hypothetical protein PHAVU_003G069000g [Phaseolus vulgaris] Length = 401 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 178 HNGRWEARIGRVFGNKYLYLGTYS 201 >ref|XP_006431090.1| hypothetical protein CICLE_v10013824mg [Citrus clementina] gi|557533147|gb|ESR44330.1| hypothetical protein CICLE_v10013824mg [Citrus clementina] Length = 393 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 182 HNGRWEARIGRVFGNKYLYLGTYS 205 >ref|XP_002315794.2| hypothetical protein POPTR_0010s10290g [Populus trichocarpa] gi|550329503|gb|EEF01965.2| hypothetical protein POPTR_0010s10290g [Populus trichocarpa] Length = 418 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 188 HNGRWEARIGRVFGNKYLYLGTYS 211 >ref|XP_006836147.1| hypothetical protein AMTR_s00101p00022740 [Amborella trichopoda] gi|548838647|gb|ERM99000.1| hypothetical protein AMTR_s00101p00022740 [Amborella trichopoda] Length = 345 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 160 HNGRWEARIGRVFGNKYLYLGTYS 183 >ref|XP_006829312.1| hypothetical protein AMTR_s00202p00017170 [Amborella trichopoda] gi|548834332|gb|ERM96728.1| hypothetical protein AMTR_s00202p00017170 [Amborella trichopoda] Length = 417 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 169 HNGRWEARIGRVFGNKYLYLGTYS 192 >gb|EOY03384.1| Integrase-type DNA-binding superfamily protein [Theobroma cacao] Length = 387 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 181 HNGRWEARIGRVFGNKYLYLGTYS 204 >ref|XP_004489378.1| PREDICTED: ethylene-responsive transcription factor WRI1-like [Cicer arietinum] Length = 371 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 173 HNGRWEARIGRVFGNKYLYLGTYS 196 >ref|XP_004489178.1| PREDICTED: AP2-like ethylene-responsive transcription factor At1g16060-like [Cicer arietinum] Length = 388 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 178 HNGRWEARIGRVFGNKYLYLGTYS 201 >gb|EMT25061.1| Ethylene-responsive transcription factor WRI1 [Aegilops tauschii] Length = 335 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -3 Query: 389 HNGRWEARIGRVFGNKYLYLGTYS 318 HNGRWEARIGRVFGNKYLYLGTYS Sbjct: 117 HNGRWEARIGRVFGNKYLYLGTYS 140