BLASTX nr result
ID: Rehmannia22_contig00033315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00033315 (485 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006475043.1| PREDICTED: DNA mismatch repair protein MSH5-... 55 7e-06 ref|XP_006452401.1| hypothetical protein CICLE_v10010304mg [Citr... 55 7e-06 >ref|XP_006475043.1| PREDICTED: DNA mismatch repair protein MSH5-like [Citrus sinensis] Length = 811 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/54 (55%), Positives = 35/54 (64%), Gaps = 10/54 (18%) Frame = -2 Query: 133 SSSHYSLMTISFIPLFTK----------SSDWTAFLKSICSLLHINKIFEVGIS 2 +S H +L + IP K +SDWTAFLKSICSLLH+NKIFEVGIS Sbjct: 266 ASLHETLKYVKDIPHILKKFNSPSFIYTASDWTAFLKSICSLLHVNKIFEVGIS 319 >ref|XP_006452401.1| hypothetical protein CICLE_v10010304mg [Citrus clementina] gi|557555627|gb|ESR65641.1| hypothetical protein CICLE_v10010304mg [Citrus clementina] Length = 799 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/54 (55%), Positives = 35/54 (64%), Gaps = 10/54 (18%) Frame = -2 Query: 133 SSSHYSLMTISFIPLFTK----------SSDWTAFLKSICSLLHINKIFEVGIS 2 +S H +L + IP K +SDWTAFLKSICSLLH+NKIFEVGIS Sbjct: 254 ASLHETLKYVKDIPHILKKFNSPSFIYTASDWTAFLKSICSLLHVNKIFEVGIS 307