BLASTX nr result
ID: Rehmannia22_contig00033131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00033131 (575 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB60103.1| Kinesin-related protein 11 [Morus notabilis] 58 2e-06 >gb|EXB60103.1| Kinesin-related protein 11 [Morus notabilis] Length = 1243 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 573 DQMDLFREQIKMLAGEVALSTSSLK*LSEQAA 478 DQMDLFREQ+KMLAGEVALSTSSLK LSEQAA Sbjct: 664 DQMDLFREQVKMLAGEVALSTSSLKRLSEQAA 695