BLASTX nr result
ID: Rehmannia22_contig00033073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00033073 (554 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS72772.1| hypothetical protein M569_01980, partial [Genlise... 102 5e-20 >gb|EPS72772.1| hypothetical protein M569_01980, partial [Genlisea aurea] Length = 483 Score = 102 bits (255), Expect = 5e-20 Identities = 50/105 (47%), Positives = 66/105 (62%), Gaps = 3/105 (2%) Frame = +1 Query: 247 SNVLKNTLNLIKIHVTSHPRFWLFITFLWVQALIISIARTPPPCFPDRTXXXXXXXXXXX 426 S + + TLN +K+H +SHPRFW FI FLW+QALIISIARTPPPCFPDR+ Sbjct: 1 SGLFRTTLNSVKMHFSSHPRFWTFIAFLWIQALIISIARTPPPCFPDRSAA--------- 51 Query: 427 XLRYLPPQDDAVSNATQKSEA---ATSLRYSEECPSGSVYAYDLP 552 +P Q + A + + A ++ YSEECPSG ++ Y+LP Sbjct: 52 ----VPVQVGSSEEAFEPNVTEIRAVAVNYSEECPSGRIFVYELP 92