BLASTX nr result
ID: Rehmannia22_contig00032880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00032880 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516480.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_002516480.1| conserved hypothetical protein [Ricinus communis] gi|223544300|gb|EEF45821.1| conserved hypothetical protein [Ricinus communis] Length = 720 Score = 55.8 bits (133), Expect = 6e-06 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 18/116 (15%) Frame = +1 Query: 1 YGYFPPYGMPITN-----ISVKQTNGPTIPNQLPAGEINIGIQNRN----------RASP 135 +GYFPPYGMPI + +V+Q N QL G NI +Q+ + R + Sbjct: 568 HGYFPPYGMPIMSSTMPGSAVEQMNYYGQAGQLSGGGANIVVQHPSLQLQKSGSIPRVNK 627 Query: 136 DGFSEDIEVQASISSSPVEKLQ---ERKSMKEINVLPLFPTSPLIDDGPNASGPEL 294 S+D E++ S +SSP E++Q ++ + + LPLFPT+P+ +G A+ P+L Sbjct: 628 PRASKDTELRGSTASSPSERVQGAGNAQAAETRDPLPLFPTAPIALEG--ATQPQL 681