BLASTX nr result
ID: Rehmannia22_contig00032685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00032685 (416 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59462.1| hypothetical protein M569_15344 [Genlisea aurea] 65 1e-08 >gb|EPS59462.1| hypothetical protein M569_15344 [Genlisea aurea] Length = 422 Score = 64.7 bits (156), Expect = 1e-08 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Frame = +1 Query: 259 MSQKR-QQQEEGSSFDDKRLRKSHSFRRVVLDVMNLMKLQNLINPVLEPLIRR 414 MS+KR Q+ E+GSS D R RKS SF+ VVLDVMN+ +LQN + PVLEPLIRR Sbjct: 1 MSKKRLQRDEDGSSSQDWRPRKSPSFKSVVLDVMNIQRLQNFMVPVLEPLIRR 53