BLASTX nr result
ID: Rehmannia22_contig00032606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00032606 (553 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB89969.1| hypothetical protein L484_023622 [Morus notabilis] 70 3e-10 >gb|EXB89969.1| hypothetical protein L484_023622 [Morus notabilis] Length = 756 Score = 70.1 bits (170), Expect = 3e-10 Identities = 36/68 (52%), Positives = 45/68 (66%) Frame = +3 Query: 171 KPNTDYVVLPDSYSIGVGAVIRDSDGCICACMSKKLRGNMSIFDAEAIALREGLEFARRT 350 K NTD V + SIG+G VIRD DG +CAC+ K++ G+ S F AE +ALREGL FA+ Sbjct: 187 KLNTDASVREGTSSIGIGVVIRDGDGIVCACLVKRIAGSFSPFLAECMALREGLIFAQER 246 Query: 351 GFAIIKVE 374 GF I E Sbjct: 247 GFFISVAE 254