BLASTX nr result
ID: Rehmannia22_contig00032254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00032254 (568 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY22678.1| Mitochondrial substrate carrier family protein is... 90 3e-16 gb|EOY22677.1| Mitochondrial substrate carrier family protein is... 90 3e-16 dbj|BAJ53112.1| JHL07K02.2 [Jatropha curcas] 89 6e-16 ref|XP_002511072.1| Succinate/fumarate mitochondrial transporter... 89 6e-16 ref|XP_002321765.1| mitochondrial substrate carrier family prote... 89 6e-16 gb|EXB79414.1| Calcium-binding mitochondrial carrier protein SCa... 87 2e-15 gb|EPS59119.1| hypothetical protein M569_15688 [Genlisea aurea] 87 2e-15 ref|XP_002318185.2| mitochondrial substrate carrier family prote... 87 3e-15 ref|XP_006485062.1| PREDICTED: calcium-binding mitochondrial car... 86 5e-15 ref|XP_006436988.1| hypothetical protein CICLE_v10031301mg [Citr... 86 5e-15 emb|CBI15774.3| unnamed protein product [Vitis vinifera] 86 5e-15 ref|XP_002284731.1| PREDICTED: calcium-binding mitochondrial car... 86 5e-15 emb|CAN83157.1| hypothetical protein VITISV_022552 [Vitis vinifera] 86 5e-15 ref|XP_004300380.1| PREDICTED: calcium-binding mitochondrial car... 86 6e-15 gb|EMJ11123.1| hypothetical protein PRUPE_ppa004514mg [Prunus pe... 86 6e-15 ref|XP_003524327.2| PREDICTED: calcium-binding mitochondrial car... 85 1e-14 ref|XP_002277297.1| PREDICTED: calcium-binding mitochondrial car... 85 1e-14 gb|EXB41417.1| Calcium-binding mitochondrial carrier protein SCa... 85 1e-14 ref|XP_006366294.1| PREDICTED: calcium-binding mitochondrial car... 84 2e-14 ref|XP_004503813.1| PREDICTED: calcium-binding mitochondrial car... 84 2e-14 >gb|EOY22678.1| Mitochondrial substrate carrier family protein isoform 2 [Theobroma cacao] Length = 505 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDLD 429 VFWRT QNEG+RGFYKGL PNLLKVVP+ASITYLVYEAMKKSLDLD Sbjct: 460 VFWRTLQNEGYRGFYKGLVPNLLKVVPAASITYLVYEAMKKSLDLD 505 >gb|EOY22677.1| Mitochondrial substrate carrier family protein isoform 1 [Theobroma cacao] Length = 504 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDLD 429 VFWRT QNEG+RGFYKGL PNLLKVVP+ASITYLVYEAMKKSLDLD Sbjct: 459 VFWRTLQNEGYRGFYKGLVPNLLKVVPAASITYLVYEAMKKSLDLD 504 >dbj|BAJ53112.1| JHL07K02.2 [Jatropha curcas] Length = 505 Score = 89.4 bits (220), Expect = 6e-16 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDL 432 VFWRT +NEG+RGFYKGLFPNLLKVVP+ASITYLVYEAMKKSLDL Sbjct: 461 VFWRTLENEGYRGFYKGLFPNLLKVVPAASITYLVYEAMKKSLDL 505 >ref|XP_002511072.1| Succinate/fumarate mitochondrial transporter, putative [Ricinus communis] gi|223550187|gb|EEF51674.1| Succinate/fumarate mitochondrial transporter, putative [Ricinus communis] Length = 510 Score = 89.4 bits (220), Expect = 6e-16 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDL 432 VFWRT QNEG++GFYKGLFPNLLKVVP+ASITYLVYEAMKKSLDL Sbjct: 466 VFWRTLQNEGYKGFYKGLFPNLLKVVPAASITYLVYEAMKKSLDL 510 >ref|XP_002321765.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|222868761|gb|EEF05892.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 505 Score = 89.4 bits (220), Expect = 6e-16 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDLD 429 VFWRT+QNEG RGFYKG+FPNLLKVVP+ASITY+VYEAMKKSL+LD Sbjct: 460 VFWRTFQNEGCRGFYKGIFPNLLKVVPAASITYMVYEAMKKSLELD 505 >gb|EXB79414.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Morus notabilis] Length = 517 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDLD 429 VFWRT + EG+RGFYKGLFPNLLKVVP+ASITYLVYE MKKSLDLD Sbjct: 472 VFWRTLREEGYRGFYKGLFPNLLKVVPAASITYLVYETMKKSLDLD 517 >gb|EPS59119.1| hypothetical protein M569_15688 [Genlisea aurea] Length = 503 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDLD 429 VFWRTYQ EG RGFYKGLFPNLLKVVP+ASITYLVYEAMKKSL L+ Sbjct: 458 VFWRTYQREGVRGFYKGLFPNLLKVVPAASITYLVYEAMKKSLHLN 503 >ref|XP_002318185.2| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550326864|gb|EEE96405.2| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 494 Score = 87.0 bits (214), Expect = 3e-15 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDLD 429 VFWRT+QNEG+ GFYKG+FPNLLKVVP+ SITY+VYEAMKKSL+LD Sbjct: 449 VFWRTFQNEGYGGFYKGIFPNLLKVVPAVSITYMVYEAMKKSLELD 494 >ref|XP_006485062.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like [Citrus sinensis] Length = 504 Score = 86.3 bits (212), Expect = 5e-15 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDL 432 VFWRT QNEG+RGFYKG+FPNLLKVVP+ASITY+VYE MKK+LDL Sbjct: 460 VFWRTLQNEGYRGFYKGIFPNLLKVVPAASITYMVYETMKKTLDL 504 >ref|XP_006436988.1| hypothetical protein CICLE_v10031301mg [Citrus clementina] gi|557539184|gb|ESR50228.1| hypothetical protein CICLE_v10031301mg [Citrus clementina] Length = 504 Score = 86.3 bits (212), Expect = 5e-15 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDL 432 VFWRT QNEG+RGFYKG+FPNLLKVVP+ASITY+VYE MKK+LDL Sbjct: 460 VFWRTLQNEGYRGFYKGIFPNLLKVVPAASITYMVYETMKKTLDL 504 >emb|CBI15774.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 86.3 bits (212), Expect = 5e-15 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDLD 429 VF RT Q+EGFRGFYKGLFPNLLKVVPSASITYLVYE MKKSLDLD Sbjct: 464 VFRRTLQHEGFRGFYKGLFPNLLKVVPSASITYLVYETMKKSLDLD 509 >ref|XP_002284731.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like [Vitis vinifera] Length = 511 Score = 86.3 bits (212), Expect = 5e-15 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDLD 429 VF RT Q+EGFRGFYKGLFPNLLKVVPSASITYLVYE MKKSLDLD Sbjct: 466 VFRRTLQHEGFRGFYKGLFPNLLKVVPSASITYLVYETMKKSLDLD 511 >emb|CAN83157.1| hypothetical protein VITISV_022552 [Vitis vinifera] Length = 496 Score = 86.3 bits (212), Expect = 5e-15 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDLD 429 VF RT Q+EGFRGFYKGLFPNLLKVVPSASITYLVYE MKKSLDLD Sbjct: 451 VFRRTLQHEGFRGFYKGLFPNLLKVVPSASITYLVYETMKKSLDLD 496 >ref|XP_004300380.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1-like [Fragaria vesca subsp. vesca] Length = 502 Score = 85.9 bits (211), Expect = 6e-15 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDL 432 VFWRT Q EG+RGFYKGLFPNLLKVVP+ASITY+VYEAMKK LDL Sbjct: 458 VFWRTLQREGYRGFYKGLFPNLLKVVPAASITYMVYEAMKKKLDL 502 >gb|EMJ11123.1| hypothetical protein PRUPE_ppa004514mg [Prunus persica] Length = 505 Score = 85.9 bits (211), Expect = 6e-15 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDL 432 VFWRT QNEG+ GFYKGLFPNLLKVVP+ASITY+VYEAMKK LDL Sbjct: 461 VFWRTLQNEGYTGFYKGLFPNLLKVVPAASITYMVYEAMKKKLDL 505 >ref|XP_003524327.2| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like isoform X1 [Glycine max] gi|571456410|ref|XP_006580382.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like isoform X2 [Glycine max] Length = 500 Score = 85.1 bits (209), Expect = 1e-14 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDLD 429 VFW+T ++EGFRGFYKGL PNLLKVVP+ASITY+VYE+MKKSLDLD Sbjct: 455 VFWKTLKDEGFRGFYKGLIPNLLKVVPAASITYMVYESMKKSLDLD 500 >ref|XP_002277297.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 [Vitis vinifera] gi|296082251|emb|CBI21256.3| unnamed protein product [Vitis vinifera] Length = 489 Score = 85.1 bits (209), Expect = 1e-14 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDLD 429 VF +T+Q+EGFRGFYKGLFPNLLKVVPSASITYLVYE MKKSL+LD Sbjct: 444 VFRKTFQHEGFRGFYKGLFPNLLKVVPSASITYLVYETMKKSLELD 489 >gb|EXB41417.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Morus notabilis] Length = 490 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDLD 429 VF RT+Q EGFRGFYKG+FPN+LKVVPSASITYLVYE+MKKSLDL+ Sbjct: 445 VFRRTFQREGFRGFYKGIFPNMLKVVPSASITYLVYESMKKSLDLE 490 >ref|XP_006366294.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like [Solanum tuberosum] Length = 375 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDLD 429 VF +T Q EGFRGFYKGLFPNLLKVVP+ASITYLVYE+MKKSLDLD Sbjct: 330 VFRKTVQREGFRGFYKGLFPNLLKVVPAASITYLVYESMKKSLDLD 375 >ref|XP_004503813.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like isoform X1 [Cicer arietinum] gi|502139557|ref|XP_004503814.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-2-like isoform X2 [Cicer arietinum] Length = 498 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -3 Query: 566 VFWRTYQNEGFRGFYKGLFPNLLKVVPSASITYLVYEAMKKSLDLD 429 VFW+T ++EGFRGFYKGL PNLLKVVP+ASITY+VYE MKKSLDLD Sbjct: 453 VFWKTLKDEGFRGFYKGLIPNLLKVVPAASITYMVYENMKKSLDLD 498