BLASTX nr result
ID: Rehmannia22_contig00032088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00032088 (493 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266817.1| PREDICTED: metaxin-2-like [Vitis vinifera] 55 1e-05 emb|CBI40120.3| unnamed protein product [Vitis vinifera] 55 1e-05 emb|CAN72044.1| hypothetical protein VITISV_004544 [Vitis vinifera] 55 1e-05 >ref|XP_002266817.1| PREDICTED: metaxin-2-like [Vitis vinifera] Length = 321 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = -2 Query: 471 KTLFGLPSNYPRCLHIYIYIKFPKIPFSLEFNLIHPNS 358 K FGLP+ P CL +YIY++F ++PF L FNLIHP+S Sbjct: 15 KPCFGLPTACPSCLPVYIYLRFAQVPFDLSFNLIHPDS 52 >emb|CBI40120.3| unnamed protein product [Vitis vinifera] Length = 326 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = -2 Query: 471 KTLFGLPSNYPRCLHIYIYIKFPKIPFSLEFNLIHPNS 358 K FGLP+ P CL +YIY++F ++PF L FNLIHP+S Sbjct: 15 KPCFGLPTACPSCLPVYIYLRFAQVPFDLSFNLIHPDS 52 >emb|CAN72044.1| hypothetical protein VITISV_004544 [Vitis vinifera] Length = 326 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = -2 Query: 471 KTLFGLPSNYPRCLHIYIYIKFPKIPFSLEFNLIHPNS 358 K FGLP+ P CL +YIY++F ++PF L FNLIHP+S Sbjct: 15 KPCFGLPTACPSCLPVYIYLRFAQVPFDLSFNLIHPDS 52