BLASTX nr result
ID: Rehmannia22_contig00032037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00032037 (321 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutell... 69 6e-10 sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase... 65 7e-09 gb|ADD12041.1| phenylalanine ammonia lyase [Cistanche deserticol... 64 2e-08 gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula] 64 3e-08 gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baical... 64 3e-08 gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza] 64 3e-08 gb|ABR14606.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza] 64 3e-08 gb|AGW27206.1| phenylalanine ammonia-lyase 3 [Salvia miltiorrhiza] 63 5e-08 emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis] 63 5e-08 gb|ADN32768.1| phenylalanine ammonia-lyase 2 [Scutellaria baical... 61 1e-07 gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia ... 58 1e-06 gb|AAK15640.1|AF326116_1 phenylalanine ammonia-lyase [Agastache ... 57 3e-06 gb|AFP49807.1| phenylalanine ammonialyase 4 [Coffea arabica] 55 9e-06 gb|AEO92029.1| phenylalanine ammonia-lyase 3 [Coffea canephora] ... 55 9e-06 >gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides] Length = 711 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 113 MAAAMENGHHSNGFCVEQKDPLNWGAAAESLKGSHLD 3 MAAA ENGH SNGFCV+Q DPLNW AAAE+L+GSHLD Sbjct: 1 MAAATENGHQSNGFCVKQNDPLNWAAAAEALQGSHLD 37 >sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase gi|2631995|emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata] Length = 713 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/38 (78%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = -2 Query: 113 MAAAMENGHH-SNGFCVEQKDPLNWGAAAESLKGSHLD 3 MAA +ENGHH +NGFCV+Q DPLNW AAAE LKGSHLD Sbjct: 1 MAAVVENGHHGNNGFCVKQNDPLNWVAAAEELKGSHLD 38 >gb|ADD12041.1| phenylalanine ammonia lyase [Cistanche deserticola] gi|289707719|gb|ADD16918.1| phenylalanine ammonia lyase [Cistanche deserticola] Length = 709 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/34 (88%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = -2 Query: 101 MENGHHSNGFCV-EQKDPLNWGAAAESLKGSHLD 3 MENGHHSN FCV E KDPLNW AAAESLKGSHLD Sbjct: 1 MENGHHSNVFCVNENKDPLNWAAAAESLKGSHLD 34 >gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula] Length = 711 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 113 MAAAMENGHHSNGFCVEQKDPLNWGAAAESLKGSHLD 3 MA A+E H SNGFCV+ DPLNWGAAAE+LKGSHLD Sbjct: 1 MAPAVEVSHRSNGFCVQLSDPLNWGAAAEALKGSHLD 37 >gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis] Length = 711 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -2 Query: 113 MAAAMENGHHSNGFCVEQKDPLNWGAAAESLKGSHLD 3 MA A+E H SNGFCV+ DPLNWGAAAE+LKGSHLD Sbjct: 1 MAPAVEVSHRSNGFCVQLSDPLNWGAAAEALKGSHLD 37 >gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza] Length = 711 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 2/36 (5%) Frame = -2 Query: 104 AMENGHH--SNGFCVEQKDPLNWGAAAESLKGSHLD 3 A ENGHH SNGFCV+Q DPLNW AAAESLKGSHLD Sbjct: 2 AAENGHHEESNGFCVKQNDPLNWVAAAESLKGSHLD 37 >gb|ABR14606.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza] Length = 711 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 2/36 (5%) Frame = -2 Query: 104 AMENGHH--SNGFCVEQKDPLNWGAAAESLKGSHLD 3 A ENGHH SNGFCV+Q DPLNW AAAESLKGSHLD Sbjct: 2 AAENGHHEESNGFCVKQNDPLNWVAAAESLKGSHLD 37 >gb|AGW27206.1| phenylalanine ammonia-lyase 3 [Salvia miltiorrhiza] Length = 760 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 TMAAAMENGHHSNGFCVEQKDPLNWGAAAESLKGSHLD 3 T A ENGH NGFCV+Q DPLNW AAAE+L+GSHLD Sbjct: 49 TSIMAAENGHSENGFCVKQSDPLNWAAAAEALQGSHLD 86 >emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis] Length = 709 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = -2 Query: 98 ENGHH-SNGFCVEQKDPLNWGAAAESLKGSHLD 3 ENGHH SNGFCV+Q DPLNW AAAESLKGSHLD Sbjct: 3 ENGHHDSNGFCVKQNDPLNWVAAAESLKGSHLD 35 >gb|ADN32768.1| phenylalanine ammonia-lyase 2 [Scutellaria baicalensis] Length = 708 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/34 (79%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = -2 Query: 101 MENGH-HSNGFCVEQKDPLNWGAAAESLKGSHLD 3 MENGH + NGFCV+Q DPLNWGAAAE+L+GSHLD Sbjct: 1 MENGHKNGNGFCVKQNDPLNWGAAAEALQGSHLD 34 >gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa] Length = 708 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/35 (82%), Positives = 30/35 (85%), Gaps = 2/35 (5%) Frame = -2 Query: 101 MENGHH-SNGFCVEQ-KDPLNWGAAAESLKGSHLD 3 MENGHH SNG CVE +DPLNW AAAESLKGSHLD Sbjct: 1 MENGHHHSNGLCVETTRDPLNWVAAAESLKGSHLD 35 >gb|AAK15640.1|AF326116_1 phenylalanine ammonia-lyase [Agastache rugosa] Length = 716 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 8/39 (20%) Frame = -2 Query: 95 NGHH--------SNGFCVEQKDPLNWGAAAESLKGSHLD 3 NGHH +NGFCV+Q DPLNW AAAESLKGSHL+ Sbjct: 4 NGHHGSNGHNNGANGFCVKQNDPLNWAAAAESLKGSHLE 42 >gb|AFP49807.1| phenylalanine ammonialyase 4 [Coffea arabica] Length = 713 Score = 55.1 bits (131), Expect = 9e-06 Identities = 28/34 (82%), Positives = 28/34 (82%), Gaps = 2/34 (5%) Frame = -2 Query: 98 ENG--HHSNGFCVEQKDPLNWGAAAESLKGSHLD 3 ENG HHSN FCV Q DPLNW AAAESLKGSHLD Sbjct: 6 ENGNVHHSNRFCV-QDDPLNWNAAAESLKGSHLD 38 >gb|AEO92029.1| phenylalanine ammonia-lyase 3 [Coffea canephora] gi|347451510|gb|AEO94541.1| phenylalanine ammonia-lyase 3 [Coffea canephora] Length = 713 Score = 55.1 bits (131), Expect = 9e-06 Identities = 28/34 (82%), Positives = 28/34 (82%), Gaps = 2/34 (5%) Frame = -2 Query: 98 ENG--HHSNGFCVEQKDPLNWGAAAESLKGSHLD 3 ENG HHSN FCV Q DPLNW AAAESLKGSHLD Sbjct: 6 ENGNVHHSNRFCV-QDDPLNWNAAAESLKGSHLD 38