BLASTX nr result
ID: Rehmannia22_contig00031820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00031820 (302 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004243745.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic i... 69 5e-10 ref|XP_006357715.1| PREDICTED: WD repeat-containing protein DWA1... 68 1e-09 ref|XP_006853931.1| hypothetical protein AMTR_s00036p00200680 [A... 59 5e-07 gb|EXB38874.1| Eukaryotic initiation factor 4A-15 [Morus notabilis] 55 1e-05 gb|EOY30394.1| DWD hypersensitive to ABA 1 [Theobroma cacao] 55 1e-05 >ref|XP_004243745.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic initiation factor 4A-9-like [Solanum lycopersicum] Length = 772 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = +1 Query: 187 MDCRNWDEDLYRDSILLDRETLSRTVFRTAFAPNPNPN 300 MDCRNW+ED+YRDSI+L+RE+ RTVFRTAFAPNP+ N Sbjct: 5 MDCRNWEEDIYRDSIILERESQCRTVFRTAFAPNPDHN 42 >ref|XP_006357715.1| PREDICTED: WD repeat-containing protein DWA1-like [Solanum tuberosum] Length = 377 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 187 MDCRNWDEDLYRDSILLDRETLSRTVFRTAFAPNPNPN 300 MDCRNWDE +YRDSI+L+RE+ RTVFRTAFAPNP+ N Sbjct: 5 MDCRNWDEGIYRDSIILERESQCRTVFRTAFAPNPDHN 42 >ref|XP_006853931.1| hypothetical protein AMTR_s00036p00200680 [Amborella trichopoda] gi|548857599|gb|ERN15398.1| hypothetical protein AMTR_s00036p00200680 [Amborella trichopoda] Length = 376 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 190 DCRNWDEDLYRDSILLDRETLSRTVFRTAFAPNPNPN 300 D RNWDE+ YR S++ +RE L+ TVFRTAFAP+PNPN Sbjct: 5 DARNWDEEGYRTSVIEEREALTLTVFRTAFAPSPNPN 41 >gb|EXB38874.1| Eukaryotic initiation factor 4A-15 [Morus notabilis] Length = 857 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +1 Query: 190 DCRNWDEDLYRDSILLDRETLSRTVFRTAFAPNPNPN 300 D NWDED YR++IL +RE +RTVFRT + P+PNPN Sbjct: 4 DATNWDEDTYREAILKEREIHTRTVFRTLWPPSPNPN 40 >gb|EOY30394.1| DWD hypersensitive to ABA 1 [Theobroma cacao] Length = 371 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = +1 Query: 190 DCRNWDEDLYRDSILLDRETLSRTVFRTAFAPNPNPN 300 D NWDE+ YR+SIL DRE +RTVFRT +AP+ NPN Sbjct: 4 DATNWDEEAYRESILRDREIQTRTVFRTVWAPSLNPN 40