BLASTX nr result
ID: Rehmannia22_contig00031809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00031809 (400 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK47820.1| unknown [Lotus japonicus] 94 2e-17 gb|EXC20790.1| hypothetical protein L484_007372 [Morus notabilis] 92 7e-17 dbj|BAA09367.1| A-type cyclin [Nicotiana tabacum] 91 1e-16 ref|NP_001237783.1| mitotic cyclin a2-type [Glycine max] gi|8573... 90 3e-16 ref|XP_006577871.1| PREDICTED: mitotic cyclin a2-type isoform X1... 90 3e-16 ref|XP_004498706.1| PREDICTED: cyclin-A2-2-like [Cicer arietinum] 90 3e-16 ref|XP_006353656.1| PREDICTED: cyclin-A2-1-like [Solanum tuberosum] 89 5e-16 ref|NP_001233768.1| cyclin A2 [Solanum lycopersicum] gi|5420276|... 89 8e-16 ref|XP_006371726.1| hypothetical protein POPTR_0018s01140g [Popu... 87 2e-15 ref|XP_002324834.2| MITOTIC-LIKE CYCLIN 3B family protein [Popul... 87 2e-15 ref|XP_006371725.1| hypothetical protein POPTR_0018s01140g [Popu... 87 2e-15 gb|EOY31367.1| Mitotic-like cyclin 3B from [Theobroma cacao] 86 4e-15 ref|XP_006476192.1| PREDICTED: cyclin-A2-1-like [Citrus sinensis] 84 1e-14 gb|ESW09068.1| hypothetical protein PHAVU_009G097500g [Phaseolus... 84 1e-14 gb|EMJ24020.1| hypothetical protein PRUPE_ppa005091mg [Prunus pe... 84 1e-14 ref|XP_003526434.1| PREDICTED: cyclin-A2-2-like [Glycine max] 84 1e-14 ref|XP_002280592.1| PREDICTED: cyclin-A2-4 [Vitis vinifera] gi|2... 84 1e-14 ref|XP_004501282.1| PREDICTED: cyclin-A2-1-like isoform X1 [Cice... 83 3e-14 ref|XP_002281863.2| PREDICTED: cyclin-A2-2-like [Vitis vinifera] 83 4e-14 emb|CBI20929.3| unnamed protein product [Vitis vinifera] 83 4e-14 >gb|AFK47820.1| unknown [Lotus japonicus] Length = 86 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/62 (74%), Positives = 50/62 (80%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 NPTLEHYT YK+S+LK VL LQDLQLNT+GC NAIREKYKH KF CV+ L S KPV S Sbjct: 22 NPTLEHYTNYKSSELKTVVLALQDLQLNTKGCPLNAIREKYKHQKFNCVANL-SPKPVQS 80 Query: 210 LF 205 LF Sbjct: 81 LF 82 >gb|EXC20790.1| hypothetical protein L484_007372 [Morus notabilis] Length = 474 Score = 92.0 bits (227), Expect = 7e-17 Identities = 44/62 (70%), Positives = 48/62 (77%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 N TLEHYTRYKTS+LK TVL ++DLQLNT GC N IREKY KFKCV+ L S KPV S Sbjct: 409 NSTLEHYTRYKTSELKTTVLAMEDLQLNTNGCPLNVIREKYTQQKFKCVANLTSIKPVGS 468 Query: 210 LF 205 LF Sbjct: 469 LF 470 >dbj|BAA09367.1| A-type cyclin [Nicotiana tabacum] Length = 493 Score = 91.3 bits (225), Expect = 1e-16 Identities = 42/62 (67%), Positives = 50/62 (80%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 NPTLEHYTRYK S+L+ TV LQ+LQ+NT GC NAIREKY+ KFK V+TL ++KPV S Sbjct: 432 NPTLEHYTRYKVSELRTTVFALQELQMNTSGCTLNAIREKYRQPKFKSVATLAASKPVQS 491 Query: 210 LF 205 LF Sbjct: 492 LF 493 >ref|NP_001237783.1| mitotic cyclin a2-type [Glycine max] gi|857395|dbj|BAA09465.1| mitotic cyclin a2-type [Glycine max] Length = 469 Score = 89.7 bits (221), Expect = 3e-16 Identities = 44/62 (70%), Positives = 48/62 (77%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 NPTLEHYT+YK SDLK VL LQDLQLNT+GC NA+REKYK KF CV+ L S K V S Sbjct: 405 NPTLEHYTKYKASDLKTVVLALQDLQLNTKGCFLNAVREKYKQQKFNCVANL-SPKSVQS 463 Query: 210 LF 205 LF Sbjct: 464 LF 465 >ref|XP_006577871.1| PREDICTED: mitotic cyclin a2-type isoform X1 [Glycine max] gi|571448503|ref|XP_006577872.1| PREDICTED: mitotic cyclin a2-type isoform X2 [Glycine max] Length = 488 Score = 89.7 bits (221), Expect = 3e-16 Identities = 44/62 (70%), Positives = 48/62 (77%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 NPTLEHYT+YK SDLK VL LQDLQLNT+GC NA+REKYK KF CV+ L S K V S Sbjct: 405 NPTLEHYTKYKASDLKTVVLALQDLQLNTKGCFLNAVREKYKQQKFNCVANL-SPKSVQS 463 Query: 210 LF 205 LF Sbjct: 464 LF 465 >ref|XP_004498706.1| PREDICTED: cyclin-A2-2-like [Cicer arietinum] Length = 423 Score = 89.7 bits (221), Expect = 3e-16 Identities = 45/62 (72%), Positives = 48/62 (77%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 NPTLEHYT YK S+LKNTVL L DLQLNT GC NA+REKYK KFK V+ L S KPV S Sbjct: 363 NPTLEHYTNYKASELKNTVLALLDLQLNTEGCCLNAVREKYKQQKFKSVANL-SAKPVES 421 Query: 210 LF 205 LF Sbjct: 422 LF 423 >ref|XP_006353656.1| PREDICTED: cyclin-A2-1-like [Solanum tuberosum] Length = 492 Score = 89.4 bits (220), Expect = 5e-16 Identities = 45/62 (72%), Positives = 47/62 (75%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 NPTLEHYT YK DLK TVL LQDLQ+NT G NAIREKYK KFK V+TL S KPV S Sbjct: 431 NPTLEHYTTYKALDLKTTVLLLQDLQMNTSGSTLNAIREKYKQPKFKSVATLSSPKPVQS 490 Query: 210 LF 205 LF Sbjct: 491 LF 492 >ref|NP_001233768.1| cyclin A2 [Solanum lycopersicum] gi|5420276|emb|CAB46642.1| cyclin A2 [Solanum lycopersicum] Length = 475 Score = 88.6 bits (218), Expect = 8e-16 Identities = 45/62 (72%), Positives = 47/62 (75%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 N TLEHYT YK SDLK TVL LQDLQ+NT G NAIREKYK KFK V+TL S KPV S Sbjct: 414 NSTLEHYTTYKASDLKTTVLLLQDLQMNTSGSTLNAIREKYKQPKFKSVATLSSPKPVQS 473 Query: 210 LF 205 LF Sbjct: 474 LF 475 >ref|XP_006371726.1| hypothetical protein POPTR_0018s01140g [Populus trichocarpa] gi|550317771|gb|ERP49523.1| hypothetical protein POPTR_0018s01140g [Populus trichocarpa] Length = 499 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/62 (67%), Positives = 48/62 (77%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 N TLEHYT Y TS+LK TVL L+DLQLNT GC NAIR+KY+ KFKCV+TL S + V S Sbjct: 438 NSTLEHYTSYTTSELKTTVLALEDLQLNTDGCCLNAIRDKYRQQKFKCVATLTSVQRVSS 497 Query: 210 LF 205 LF Sbjct: 498 LF 499 >ref|XP_002324834.2| MITOTIC-LIKE CYCLIN 3B family protein [Populus trichocarpa] gi|550317770|gb|EEF03399.2| MITOTIC-LIKE CYCLIN 3B family protein [Populus trichocarpa] Length = 433 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/62 (67%), Positives = 48/62 (77%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 N TLEHYT Y TS+LK TVL L+DLQLNT GC NAIR+KY+ KFKCV+TL S + V S Sbjct: 372 NSTLEHYTSYTTSELKTTVLALEDLQLNTDGCCLNAIRDKYRQQKFKCVATLTSVQRVSS 431 Query: 210 LF 205 LF Sbjct: 432 LF 433 >ref|XP_006371725.1| hypothetical protein POPTR_0018s01140g [Populus trichocarpa] gi|550317769|gb|ERP49522.1| hypothetical protein POPTR_0018s01140g [Populus trichocarpa] Length = 368 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/62 (67%), Positives = 48/62 (77%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 N TLEHYT Y TS+LK TVL L+DLQLNT GC NAIR+KY+ KFKCV+TL S + V S Sbjct: 307 NSTLEHYTSYTTSELKTTVLALEDLQLNTDGCCLNAIRDKYRQQKFKCVATLTSVQRVSS 366 Query: 210 LF 205 LF Sbjct: 367 LF 368 >gb|EOY31367.1| Mitotic-like cyclin 3B from [Theobroma cacao] Length = 501 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/62 (66%), Positives = 48/62 (77%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 NPTLEHYT +K S+LK TVL L+DLQLNT GC NAIREKY+ KFKCV+T + + V S Sbjct: 438 NPTLEHYTSFKASELKTTVLALEDLQLNTNGCSLNAIREKYRQQKFKCVATRTAPESVVS 497 Query: 210 LF 205 LF Sbjct: 498 LF 499 >ref|XP_006476192.1| PREDICTED: cyclin-A2-1-like [Citrus sinensis] Length = 486 Score = 84.3 bits (207), Expect = 1e-14 Identities = 41/62 (66%), Positives = 48/62 (77%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 N TLEHYT YK S+LK TVL L+DLQLNT GC NAIREKY+ KFKCV+T+ T+ V S Sbjct: 423 NSTLEHYTSYKASELKCTVLALEDLQLNTDGCSLNAIREKYRQEKFKCVATMTPTERVLS 482 Query: 210 LF 205 +F Sbjct: 483 VF 484 >gb|ESW09068.1| hypothetical protein PHAVU_009G097500g [Phaseolus vulgaris] Length = 484 Score = 84.3 bits (207), Expect = 1e-14 Identities = 41/62 (66%), Positives = 47/62 (75%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 NPTLEHY YK S+LK VL LQDLQLN++GC NA+R+KYK KF CV+ L S KPV S Sbjct: 420 NPTLEHYANYKASELKTVVLALQDLQLNSKGCPLNAVRDKYKLQKFNCVANL-SPKPVQS 478 Query: 210 LF 205 LF Sbjct: 479 LF 480 >gb|EMJ24020.1| hypothetical protein PRUPE_ppa005091mg [Prunus persica] Length = 477 Score = 84.3 bits (207), Expect = 1e-14 Identities = 40/58 (68%), Positives = 47/58 (81%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPV 217 NPTLE YT YKTS+LK TV+ L+DLQLNT+GC NAIREKY+H KFK V+TL S + V Sbjct: 413 NPTLERYTSYKTSELKTTVVALEDLQLNTKGCPLNAIREKYRHQKFKSVATLTSKQRV 470 >ref|XP_003526434.1| PREDICTED: cyclin-A2-2-like [Glycine max] Length = 469 Score = 84.3 bits (207), Expect = 1e-14 Identities = 42/62 (67%), Positives = 47/62 (75%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 NPTLEHYT+YK S+LK VL LQDLQLNT+G NA+ EKYK KF CV+ L S KPV S Sbjct: 405 NPTLEHYTKYKASELKTVVLALQDLQLNTKGSSLNAVPEKYKQQKFNCVANL-SPKPVQS 463 Query: 210 LF 205 LF Sbjct: 464 LF 465 >ref|XP_002280592.1| PREDICTED: cyclin-A2-4 [Vitis vinifera] gi|297743331|emb|CBI36198.3| unnamed protein product [Vitis vinifera] Length = 490 Score = 84.3 bits (207), Expect = 1e-14 Identities = 41/62 (66%), Positives = 47/62 (75%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 NPTLEHYTRYK SDLK V LQDLQLNT GC NAIR KY+ +KFK V++L S K + + Sbjct: 429 NPTLEHYTRYKASDLKTAVFALQDLQLNTSGCPLNAIRGKYRQNKFKSVASLSSPKLLQT 488 Query: 210 LF 205 LF Sbjct: 489 LF 490 >ref|XP_004501282.1| PREDICTED: cyclin-A2-1-like isoform X1 [Cicer arietinum] gi|502132270|ref|XP_004501283.1| PREDICTED: cyclin-A2-1-like isoform X2 [Cicer arietinum] gi|502132273|ref|XP_004501284.1| PREDICTED: cyclin-A2-1-like isoform X3 [Cicer arietinum] Length = 493 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/61 (68%), Positives = 46/61 (75%) Frame = -2 Query: 387 PTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHSL 208 PTLEHYT YK S+LK VL L+DLQLNT+ C NAIREKYK KF CV+ L S KPV SL Sbjct: 430 PTLEHYTNYKASELKIVVLALEDLQLNTKACSLNAIREKYKQDKFNCVAKL-SPKPVQSL 488 Query: 207 F 205 F Sbjct: 489 F 489 >ref|XP_002281863.2| PREDICTED: cyclin-A2-2-like [Vitis vinifera] Length = 533 Score = 82.8 bits (203), Expect = 4e-14 Identities = 42/62 (67%), Positives = 45/62 (72%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 N TLEHYT YK SDLKN VL +QDLQLNT G NAIR+KYK KFK V+TL S K V Sbjct: 470 NATLEHYTTYKASDLKNVVLAMQDLQLNTNGSSLNAIRDKYKLKKFKSVATLSSEKAVQE 529 Query: 210 LF 205 LF Sbjct: 530 LF 531 >emb|CBI20929.3| unnamed protein product [Vitis vinifera] Length = 401 Score = 82.8 bits (203), Expect = 4e-14 Identities = 42/62 (67%), Positives = 45/62 (72%) Frame = -2 Query: 390 NPTLEHYTRYKTSDLKNTVLELQDLQLNTRGCVHNAIREKYKHSKFKCVSTLRSTKPVHS 211 N TLEHYT YK SDLKN VL +QDLQLNT G NAIR+KYK KFK V+TL S K V Sbjct: 338 NATLEHYTTYKASDLKNVVLAMQDLQLNTNGSSLNAIRDKYKLKKFKSVATLSSEKAVQE 397 Query: 210 LF 205 LF Sbjct: 398 LF 399