BLASTX nr result
ID: Rehmannia22_contig00031519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00031519 (991 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509829.1| conserved hypothetical protein [Ricinus comm... 62 6e-09 >ref|XP_002509829.1| conserved hypothetical protein [Ricinus communis] gi|223549728|gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 62.0 bits (149), Expect(2) = 6e-09 Identities = 31/91 (34%), Positives = 51/91 (56%) Frame = +3 Query: 468 SYVPKNYRSLIQAMITFVIFLHDKTHKSLLNGFSGQNLVVLDGTLKFWKVAFTDPTPVTM 647 +YVP YR LI++M+TFV+ +HD + + GF N+V+ + +KFWKV F + + Sbjct: 111 NYVPNEYRKLIKSMVTFVVDIHDAGYSTA--GFGMPNIVIKNEVVKFWKVQFITASMGSK 168 Query: 648 KNDLR*LYHVPTNKLSTGGYTAIPSDMDHLI 740 ND L+ V + S + +P +M H + Sbjct: 169 NNDFICLHRVVESLFSGEQHLHLPREMQHFL 199 Score = 25.8 bits (55), Expect(2) = 6e-09 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +2 Query: 845 VISFYSINDGM*LKNHLAVISSAKRLSFFKDAFDKR 952 +IS D + H+A++S +R+SFF D ++++ Sbjct: 202 LISGTQSEDEYLISRHVAIMSHDERVSFFTDCWERQ 237