BLASTX nr result
ID: Rehmannia22_contig00031310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00031310 (347 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71417.1| hypothetical protein M569_03329 [Genlisea aurea] 57 3e-06 >gb|EPS71417.1| hypothetical protein M569_03329 [Genlisea aurea] Length = 723 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/49 (61%), Positives = 31/49 (63%) Frame = -2 Query: 148 ISCRRHLRIPVSCRRFPKDPGESRQPKRRDVLITPFLAAGAYAFRSAVA 2 I CRR + V CRR S KRRDVLITPFLAAGAY RSAVA Sbjct: 19 IGCRRCVSFQVRCRRVSDSSDNSHGCKRRDVLITPFLAAGAYVLRSAVA 67