BLASTX nr result
ID: Rehmannia22_contig00031239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00031239 (556 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ15703.1| hypothetical protein PRUPE_ppa016706mg, partial [... 45 7e-06 >gb|EMJ15703.1| hypothetical protein PRUPE_ppa016706mg, partial [Prunus persica] Length = 992 Score = 44.7 bits (104), Expect(2) = 7e-06 Identities = 19/48 (39%), Positives = 28/48 (58%) Frame = +3 Query: 15 PKKVQLFSWLVILGKIPICDVVQRRNQYILLHPYLCTV*ASFGDSCTH 158 P KV++F W +LGK+ D VQRR Y+ + P+ C + G+S H Sbjct: 865 PPKVKIFMWQAVLGKLSTGDTVQRRCPYLCISPHWCALCNKAGESVDH 912 Score = 30.8 bits (68), Expect(2) = 7e-06 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +2 Query: 152 YTFLHCSFVR*LWSNILTELDFIGVIPQLGSELF 253 + LHC F LW +L E++ + VIP+ ELF Sbjct: 912 HLLLHCPFSLKLWETLLKEVNTVWVIPEGCFELF 945