BLASTX nr result
ID: Rehmannia22_contig00031182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00031182 (408 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006404635.1| hypothetical protein EUTSA_v10000480mg, part... 57 3e-06 ref|XP_003525096.1| PREDICTED: ribonucleoside-diphosphate reduct... 57 3e-06 gb|EXB64472.1| Ribonucleoside-diphosphate reductase large subuni... 56 4e-06 gb|ESW31790.1| hypothetical protein PHAVU_002G267900g [Phaseolus... 56 4e-06 gb|ESW31789.1| hypothetical protein PHAVU_002G267900g [Phaseolus... 56 4e-06 gb|AFF18831.1| ribonucleotide reductase large subunit A, partial... 56 6e-06 ref|XP_006648070.1| PREDICTED: ribonucleoside-diphosphate reduct... 55 7e-06 ref|XP_006346731.1| PREDICTED: ribonucleoside-diphosphate reduct... 55 7e-06 gb|ESW09287.1| hypothetical protein PHAVU_009G115100g [Phaseolus... 55 7e-06 gb|EOX92350.1| Ribonucleotide reductase 1 isoform 4, partial [Th... 55 7e-06 gb|EOX92349.1| Ribonucleotide reductase 1 isoform 3 [Theobroma c... 55 7e-06 gb|EOX92348.1| Ribonucleotide reductase 1 isoform 2, partial [Th... 55 7e-06 gb|EOX92347.1| Ribonucleotide reductase 1 isoform 1 [Theobroma c... 55 7e-06 ref|XP_004236709.1| PREDICTED: ribonucleoside-diphosphate reduct... 55 7e-06 ref|NP_001236466.1| ribonucleotide reductase large subunit B [Gl... 55 7e-06 ref|XP_003523246.1| PREDICTED: ribonucleoside-diphosphate reduct... 55 7e-06 ref|XP_003630166.1| Ribonucleoside-diphosphate reductase [Medica... 55 7e-06 ref|XP_002307143.1| ribonucleotide reductase large subunit B fam... 55 1e-05 >ref|XP_006404635.1| hypothetical protein EUTSA_v10000480mg, partial [Eutrema salsugineum] gi|557105763|gb|ESQ46088.1| hypothetical protein EUTSA_v10000480mg, partial [Eutrema salsugineum] Length = 415 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPEGIWTVFRYAIPLSSAQFA 133 HRPIGIGVQGLAD FILLG+ FDSP+ I+ + Y +S+Q A Sbjct: 358 HRPIGIGVQGLADAFILLGMPFDSPKDIFEIIYYHALKASSQLA 401 >ref|XP_003525096.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit [Glycine max] gi|27261142|gb|AAN87547.1|AF118784_1 ribonucleotide reductase large subunit A [Glycine max] Length = 809 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/60 (51%), Positives = 39/60 (65%), Gaps = 7/60 (11%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPEG-------IWTVFRYAIPLSSAQFALQPTNQLFS 160 HRPIGIGVQGLADTFILLG+AFDSPE T++ +A+ SS A + + +S Sbjct: 517 HRPIGIGVQGLADTFILLGVAFDSPEAQQLNKDIFETIYYHALKTSSELAAKEGPYETYS 576 >gb|EXB64472.1| Ribonucleoside-diphosphate reductase large subunit [Morus notabilis] Length = 889 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/47 (61%), Positives = 34/47 (72%), Gaps = 7/47 (14%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPEG-------IWTVFRYAIPLSS 121 HRPIGIGVQGLADTFILLG+AFDSPE T++ +A+ SS Sbjct: 517 HRPIGIGVQGLADTFILLGMAFDSPEAQQLNKDIFETIYYHALKTSS 563 >gb|ESW31790.1| hypothetical protein PHAVU_002G267900g [Phaseolus vulgaris] Length = 809 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/47 (61%), Positives = 34/47 (72%), Gaps = 7/47 (14%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPEG-------IWTVFRYAIPLSS 121 HRPIGIGVQGLADTFILLG+AFDSPE T++ +A+ SS Sbjct: 517 HRPIGIGVQGLADTFILLGMAFDSPEAQQLNKDIFETIYYHALKTSS 563 >gb|ESW31789.1| hypothetical protein PHAVU_002G267900g [Phaseolus vulgaris] Length = 810 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/47 (61%), Positives = 34/47 (72%), Gaps = 7/47 (14%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPEG-------IWTVFRYAIPLSS 121 HRPIGIGVQGLADTFILLG+AFDSPE T++ +A+ SS Sbjct: 517 HRPIGIGVQGLADTFILLGMAFDSPEAQQLNKDIFETIYYHALKTSS 563 >gb|AFF18831.1| ribonucleotide reductase large subunit A, partial [Dimocarpus longan] Length = 421 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 7/59 (11%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPEG-------IWTVFRYAIPLSSAQFALQPTNQLF 157 HRPIGIGVQGLADTFILLG+AFDSPE T++ +A+ S+ A + + + + Sbjct: 202 HRPIGIGVQGLADTFILLGMAFDSPEAQQLNKDIFETIYYHALKASAEMAAKEGSYETY 260 >ref|XP_006648070.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit-like [Oryza brachyantha] Length = 810 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPE 79 HRPIGIGVQGLADTFILLG+AFDSPE Sbjct: 517 HRPIGIGVQGLADTFILLGMAFDSPE 542 >ref|XP_006346731.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit-like [Solanum tuberosum] Length = 808 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/47 (59%), Positives = 34/47 (72%), Gaps = 7/47 (14%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPEG-------IWTVFRYAIPLSS 121 HRPIG+GVQGLADTFILLG+AFDSPE T++ +A+ SS Sbjct: 517 HRPIGLGVQGLADTFILLGMAFDSPEAQQLNKDIFETIYYHALKASS 563 >gb|ESW09287.1| hypothetical protein PHAVU_009G115100g [Phaseolus vulgaris] Length = 815 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPE 79 HRPIGIGVQGLADTFILLG+AFDSPE Sbjct: 517 HRPIGIGVQGLADTFILLGMAFDSPE 542 >gb|EOX92350.1| Ribonucleotide reductase 1 isoform 4, partial [Theobroma cacao] Length = 648 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPE 79 HRPIGIGVQGLADTFILLG+AFDSPE Sbjct: 467 HRPIGIGVQGLADTFILLGMAFDSPE 492 >gb|EOX92349.1| Ribonucleotide reductase 1 isoform 3 [Theobroma cacao] Length = 702 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPE 79 HRPIGIGVQGLADTFILLG+AFDSPE Sbjct: 437 HRPIGIGVQGLADTFILLGMAFDSPE 462 >gb|EOX92348.1| Ribonucleotide reductase 1 isoform 2, partial [Theobroma cacao] Length = 612 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPE 79 HRPIGIGVQGLADTFILLG+AFDSPE Sbjct: 431 HRPIGIGVQGLADTFILLGMAFDSPE 456 >gb|EOX92347.1| Ribonucleotide reductase 1 isoform 1 [Theobroma cacao] Length = 807 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPE 79 HRPIGIGVQGLADTFILLG+AFDSPE Sbjct: 517 HRPIGIGVQGLADTFILLGMAFDSPE 542 >ref|XP_004236709.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit-like [Solanum lycopersicum] Length = 808 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/47 (59%), Positives = 34/47 (72%), Gaps = 7/47 (14%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPEG-------IWTVFRYAIPLSS 121 HRPIG+GVQGLADTFILLG+AFDSPE T++ +A+ SS Sbjct: 517 HRPIGLGVQGLADTFILLGMAFDSPEAQQLNKDIFETIYYHALKASS 563 >ref|NP_001236466.1| ribonucleotide reductase large subunit B [Glycine max] gi|27261144|gb|AAN87548.1|AF118785_1 ribonucleotide reductase large subunit B [Glycine max] Length = 808 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPE 79 HRPIGIGVQGLADTFILLG+AFDSPE Sbjct: 517 HRPIGIGVQGLADTFILLGMAFDSPE 542 >ref|XP_003523246.1| PREDICTED: ribonucleoside-diphosphate reductase large subunit-like [Glycine max] Length = 808 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPE 79 HRPIGIGVQGLADTFILLG+AFDSPE Sbjct: 517 HRPIGIGVQGLADTFILLGMAFDSPE 542 >ref|XP_003630166.1| Ribonucleoside-diphosphate reductase [Medicago truncatula] gi|355524188|gb|AET04642.1| Ribonucleoside-diphosphate reductase [Medicago truncatula] Length = 819 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPE 79 HRPIGIGVQGLADTFILLG+AFDSPE Sbjct: 524 HRPIGIGVQGLADTFILLGMAFDSPE 549 >ref|XP_002307143.1| ribonucleotide reductase large subunit B family protein [Populus trichocarpa] gi|222856592|gb|EEE94139.1| ribonucleotide reductase large subunit B family protein [Populus trichocarpa] Length = 817 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/47 (59%), Positives = 34/47 (72%), Gaps = 7/47 (14%) Frame = +2 Query: 2 HRPIGIGVQGLADTFILLGLAFDSPEG-------IWTVFRYAIPLSS 121 HRPIGIGVQGLADTFILLG++FDSPE T++ +A+ SS Sbjct: 517 HRPIGIGVQGLADTFILLGMSFDSPEAQKLNKDIFETIYYHALKASS 563