BLASTX nr result
ID: Rehmannia22_contig00030996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00030996 (463 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004248174.1| PREDICTED: putative late blight resistance p... 60 2e-07 ref|XP_006362840.1| PREDICTED: putative late blight resistance p... 56 4e-06 gb|EPS69725.1| hypothetical protein M569_05040 [Genlisea aurea] 55 1e-05 ref|XP_004248175.1| PREDICTED: putative late blight resistance p... 55 1e-05 >ref|XP_004248174.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like [Solanum lycopersicum] Length = 889 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/90 (36%), Positives = 49/90 (54%), Gaps = 4/90 (4%) Frame = -3 Query: 461 AFRGPKWEVEDYGFRRLGFLLIEDTDLVHWTVGHRSIPKLLYIFLKSCYKIEKI----IL 294 AF+G +WE D F++L FLL++ TDL+HW V PKL + LK+CY + +I Sbjct: 783 AFQGSEWESTDERFQQLKFLLLDGTDLIHWIVDSIQFPKLESLVLKNCYCLSEIPDDVAE 842 Query: 293 AKYLPNIELVDCNPLGVTCAQQLKKNGHLM 204 L IEL C+ A ++++ H M Sbjct: 843 IPTLQFIELYHCSSSADVSANRIQEEQHSM 872 >ref|XP_006362840.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like [Solanum tuberosum] Length = 876 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/88 (34%), Positives = 49/88 (55%), Gaps = 7/88 (7%) Frame = -3 Query: 461 AFRGPKWEVEDYGFRRLGFLLIEDTDLVHW---TVGHRSIPKLLYIFLKSCYKIEKIIL- 294 +F+GP+WE ++ GF RL +LL+E DLV W + P L ++ L+ CYK+++I Sbjct: 771 SFQGPEWETDEEGFHRLKYLLVESRDLVVWKQASTDSYPFPVLQHLVLRFCYKLKEIPYE 830 Query: 293 ---AKYLPNIELVDCNPLGVTCAQQLKK 219 L I+L C+P A+ ++K Sbjct: 831 IGDIPSLQVIKLHSCSPYATRLARMIEK 858 >gb|EPS69725.1| hypothetical protein M569_05040 [Genlisea aurea] Length = 121 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 2/83 (2%) Frame = -3 Query: 461 AFRGPKWEVEDYGFRRLGFLLIEDTDLVHWTVGHRSIPKLLYIFLKSCYKIEKII--LAK 288 AF G KW+++ GF L +L IE +DL WTV S KL Y+ +K+C K+ I L + Sbjct: 19 AFIGEKWQIDGSGFHSLEYLYIERSDLTLWTVSENSFEKLRYLVIKNCEKLLNIPDGLVR 78 Query: 287 YLPNIELVDCNPLGVTCAQQLKK 219 L +E+ + ++ QL+K Sbjct: 79 KLKTLEVERVSRDAMSSLNQLEK 101 >ref|XP_004248175.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like [Solanum lycopersicum] Length = 258 Score = 55.1 bits (131), Expect = 1e-05 Identities = 35/94 (37%), Positives = 45/94 (47%), Gaps = 7/94 (7%) Frame = -3 Query: 461 AFRGPKWEVEDYGFRRLGFLLIEDTDLVHWTVGHRSIPKLLYIFLKSCYKIEKI----IL 294 AF+G +WE D GFR L L I T+L HW P+L +FLK C + +I + Sbjct: 153 AFKGTQWEPLDGGFRLLRVLHIGRTNLEHWNASGHHFPRLQQVFLKHCSSLNEIPFGLVE 212 Query: 293 AKYLPNIELVDCNPLGVTCA---QQLKKNGHLMD 201 L NIEL P A QQ K+ G + D Sbjct: 213 VSSLQNIELFWPTPAAAASARIIQQEKQEGDIKD 246