BLASTX nr result
ID: Rehmannia22_contig00030946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00030946 (329 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60694.1| hypothetical protein M569_14109 [Genlisea aurea] 64 3e-08 >gb|EPS60694.1| hypothetical protein M569_14109 [Genlisea aurea] Length = 1038 Score = 63.5 bits (153), Expect = 3e-08 Identities = 38/93 (40%), Positives = 56/93 (60%), Gaps = 3/93 (3%) Frame = -2 Query: 298 SAVASRSLSGSPEDGTMPK-VNRQHWDLNTLTDAWDKPYDDSIAGNTSKDVDDIHMEERQ 122 S AS L + ED T+P ++R+HWDLN L DAWD+P D++AG T +DD ++E+R Sbjct: 181 SVSASADLCRTTEDVTLPHALDRKHWDLNVLMDAWDEPC-DAVAG-TKDIIDDSNLEKRS 238 Query: 121 KVCD--DRVLSNPGSTKDESSNLKIEENKSTIV 29 + V+ G+T + NLK +EN S +V Sbjct: 239 EESSPHQSVVDAGGATSSQLPNLKRKENNSAVV 271