BLASTX nr result
ID: Rehmannia22_contig00030360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00030360 (452 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006431228.1| hypothetical protein CICLE_v10013136mg [Citr... 56 4e-06 gb|EOY03605.1| Membrane-anchored ubiquitin-fold protein 1 precur... 56 6e-06 gb|EMJ18386.1| hypothetical protein PRUPE_ppa013551mg [Prunus pe... 55 7e-06 >ref|XP_006431228.1| hypothetical protein CICLE_v10013136mg [Citrus clementina] gi|567877281|ref|XP_006431230.1| hypothetical protein CICLE_v10013136mg [Citrus clementina] gi|568858293|ref|XP_006482688.1| PREDICTED: membrane-anchored ubiquitin-fold protein 2-like isoform X3 [Citrus sinensis] gi|557533285|gb|ESR44468.1| hypothetical protein CICLE_v10013136mg [Citrus clementina] gi|557533287|gb|ESR44470.1| hypothetical protein CICLE_v10013136mg [Citrus clementina] Length = 117 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = -3 Query: 450 GVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 346 G VTTMHVVVQ P TEKEKK S PKQN C CVIL Sbjct: 83 GGVTTMHVVVQPPSTEKEKKAASQPKQNKCVCVIL 117 >gb|EOY03605.1| Membrane-anchored ubiquitin-fold protein 1 precursor isoform 1 [Theobroma cacao] Length = 117 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 450 GVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 346 G VTTMHVVVQ PP EKEKK + PKQN C CVIL Sbjct: 83 GGVTTMHVVVQPPPLEKEKKATNQPKQNKCVCVIL 117 >gb|EMJ18386.1| hypothetical protein PRUPE_ppa013551mg [Prunus persica] Length = 117 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/35 (77%), Positives = 27/35 (77%) Frame = -3 Query: 450 GVVTTMHVVVQQPPTEKEKKLPSNPKQNSCGCVIL 346 G VTTMHVVVQ P EKEKKL S PKQN C CVIL Sbjct: 83 GGVTTMHVVVQPPSLEKEKKLMSEPKQNKCVCVIL 117