BLASTX nr result
ID: Rehmannia22_contig00030040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00030040 (377 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343077.1| PREDICTED: rop guanine nucleotide exchange f... 57 3e-06 ref|XP_004166838.1| PREDICTED: LOW QUALITY PROTEIN: rho guanine ... 57 3e-06 ref|XP_004141842.1| PREDICTED: rho guanine nucleotide exchange f... 57 3e-06 ref|NP_001234159.1| pollen-specific kinase partner protein [Sola... 57 3e-06 gb|ESW22627.1| hypothetical protein PHAVU_005G168700g [Phaseolus... 56 6e-06 gb|ESW07669.1| hypothetical protein PHAVU_010G148900g [Phaseolus... 55 9e-06 gb|EPS70166.1| hypothetical protein M569_04593, partial [Genlise... 55 9e-06 ref|XP_003597746.1| Rop guanine nucleotide exchange factor [Medi... 55 9e-06 ref|NP_001142126.1| hypothetical protein [Zea mays] gi|194707236... 55 9e-06 >ref|XP_006343077.1| PREDICTED: rop guanine nucleotide exchange factor 12-like [Solanum tuberosum] Length = 502 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 RAETILLILKHRFPGLPQSDLDISKIQCNR 90 RAETILLILKHRFPG+PQS LDISKIQ NR Sbjct: 335 RAETILLILKHRFPGIPQSSLDISKIQYNR 364 >ref|XP_004166838.1| PREDICTED: LOW QUALITY PROTEIN: rho guanine nucleotide exchange factor 8-like [Cucumis sativus] Length = 553 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 RAETILLILKHRFPGLPQSDLDISKIQCNR 90 RAETILLILKHRFPG+PQS LDISKIQ NR Sbjct: 390 RAETILLILKHRFPGIPQSSLDISKIQFNR 419 >ref|XP_004141842.1| PREDICTED: rho guanine nucleotide exchange factor 8-like [Cucumis sativus] Length = 676 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 RAETILLILKHRFPGLPQSDLDISKIQCNR 90 RAETILLILKHRFPG+PQS LDISKIQ NR Sbjct: 513 RAETILLILKHRFPGIPQSSLDISKIQFNR 542 >ref|NP_001234159.1| pollen-specific kinase partner protein [Solanum lycopersicum] gi|57869094|gb|AAW57535.1| pollen-specific kinase partner protein [Solanum lycopersicum] Length = 502 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 RAETILLILKHRFPGLPQSDLDISKIQCNR 90 RAETILLILKHRFPG+PQS LDISKIQ NR Sbjct: 335 RAETILLILKHRFPGIPQSSLDISKIQYNR 364 >gb|ESW22627.1| hypothetical protein PHAVU_005G168700g [Phaseolus vulgaris] Length = 537 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 RAETILLILKHRFPGLPQSDLDISKIQCNR 90 RAETILL+LKHRFPGLPQS LDISKIQ NR Sbjct: 373 RAETILLLLKHRFPGLPQSALDISKIQYNR 402 >gb|ESW07669.1| hypothetical protein PHAVU_010G148900g [Phaseolus vulgaris] Length = 533 Score = 55.1 bits (131), Expect = 9e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 RAETILLILKHRFPGLPQSDLDISKIQCNR 90 RAETILL+LKHRFPG+PQS LDISKIQ NR Sbjct: 370 RAETILLLLKHRFPGIPQSALDISKIQFNR 399 >gb|EPS70166.1| hypothetical protein M569_04593, partial [Genlisea aurea] Length = 413 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 1 RAETILLILKHRFPGLPQSDLDISKIQCNR 90 RA+TIL ILKH+FPG+ QSDLDI+KIQCNR Sbjct: 279 RAQTILFILKHKFPGIAQSDLDITKIQCNR 308 >ref|XP_003597746.1| Rop guanine nucleotide exchange factor [Medicago truncatula] gi|332688643|gb|AEE89674.1| RopGEF12 [Medicago truncatula] gi|355486794|gb|AES67997.1| Rop guanine nucleotide exchange factor [Medicago truncatula] Length = 533 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 RAETILLILKHRFPGLPQSDLDISKIQCNR 90 RAETILL++KHRFPG+PQS LDISKIQ NR Sbjct: 371 RAETILLLIKHRFPGIPQSSLDISKIQFNR 400 >ref|NP_001142126.1| hypothetical protein [Zea mays] gi|194707236|gb|ACF87702.1| unknown [Zea mays] gi|413946480|gb|AFW79129.1| hypothetical protein ZEAMMB73_851491 [Zea mays] Length = 471 Score = 55.1 bits (131), Expect = 9e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +1 Query: 1 RAETILLILKHRFPGLPQSDLDISKIQCNRVRIALFFLI 117 RAE +LL++KHRFPG+ QS LDISKIQCN+V + L L+ Sbjct: 348 RAENVLLLIKHRFPGIAQSALDISKIQCNKVCMGLGCLV 386