BLASTX nr result
ID: Rehmannia22_contig00030023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00030023 (315 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27263.3| unnamed protein product [Vitis vinifera] 63 4e-08 ref|XP_002274691.1| PREDICTED: COBW domain-containing protein 1-... 63 4e-08 gb|AFK35605.1| unknown [Lotus japonicus] 59 9e-07 gb|ESW25527.1| hypothetical protein PHAVU_003G043500g [Phaseolus... 57 2e-06 ref|XP_006484175.1| PREDICTED: COBW domain-containing protein 1-... 57 3e-06 ref|XP_006484174.1| PREDICTED: COBW domain-containing protein 1-... 57 3e-06 gb|EMJ24497.1| hypothetical protein PRUPE_ppa007281mg [Prunus pe... 57 3e-06 ref|XP_004239064.1| PREDICTED: COBW domain-containing protein 1-... 57 3e-06 ref|XP_006348708.1| PREDICTED: COBW domain-containing protein 1-... 56 4e-06 ref|XP_004297252.1| PREDICTED: COBW domain-containing protein 1-... 56 4e-06 ref|XP_002312279.1| cobalamin synthesis/P47K family protein [Pop... 56 4e-06 ref|XP_004168945.1| PREDICTED: COBW domain-containing protein 1-... 56 6e-06 ref|XP_004144180.1| PREDICTED: COBW domain-containing protein 1-... 56 6e-06 ref|XP_003516351.1| PREDICTED: COBW domain-containing protein 1-... 56 6e-06 >emb|CBI27263.3| unnamed protein product [Vitis vinifera] Length = 621 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 313 YEIVPTRRWKDEENRVNKIVFIGRSLNEDILVNTLGAC 200 YEIVPTR+WK+EEN++NKIVFIG +LNED L N+ AC Sbjct: 326 YEIVPTRKWKNEENQMNKIVFIGHNLNEDALTNSFRAC 363 >ref|XP_002274691.1| PREDICTED: COBW domain-containing protein 1-like [Vitis vinifera] Length = 368 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 313 YEIVPTRRWKDEENRVNKIVFIGRSLNEDILVNTLGAC 200 YEIVPTR+WK+EEN++NKIVFIG +LNED L N+ AC Sbjct: 326 YEIVPTRKWKNEENQMNKIVFIGHNLNEDALTNSFRAC 363 >gb|AFK35605.1| unknown [Lotus japonicus] Length = 390 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -3 Query: 313 YEIVPTRRWKDEENRVNKIVFIGRSLNEDILVNTLGAC 200 YEIVP R+W+ EENR+NKIVFIG +L ED+L+++ AC Sbjct: 350 YEIVPARKWEREENRMNKIVFIGHNLKEDVLIHSFRAC 387 >gb|ESW25527.1| hypothetical protein PHAVU_003G043500g [Phaseolus vulgaris] Length = 364 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 313 YEIVPTRRWKDEENRVNKIVFIGRSLNEDILVNT 212 YEIVP+R+WK EE R+NKIVFIG +L EDIL+N+ Sbjct: 324 YEIVPSRKWKKEEKRINKIVFIGHNLKEDILINS 357 >ref|XP_006484175.1| PREDICTED: COBW domain-containing protein 1-like isoform X2 [Citrus sinensis] Length = 341 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -3 Query: 313 YEIVPTRRWKDEENRVNKIVFIGRSLNEDILVNTLGACT 197 YEIVP R+W+ EEN++NKIVFIG LN+DIL ++ CT Sbjct: 299 YEIVPARKWRTEENQMNKIVFIGHHLNQDILQDSFRTCT 337 >ref|XP_006484174.1| PREDICTED: COBW domain-containing protein 1-like isoform X1 [Citrus sinensis] Length = 371 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -3 Query: 313 YEIVPTRRWKDEENRVNKIVFIGRSLNEDILVNTLGACT 197 YEIVP R+W+ EEN++NKIVFIG LN+DIL ++ CT Sbjct: 329 YEIVPARKWRTEENQMNKIVFIGHHLNQDILQDSFRTCT 367 >gb|EMJ24497.1| hypothetical protein PRUPE_ppa007281mg [Prunus persica] Length = 374 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 313 YEIVPTRRWKDEENRVNKIVFIGRSLNEDILVNTLGAC 200 YEIVPTR WK +EN+ NKIVFIG +LNE++L + AC Sbjct: 335 YEIVPTRDWKKQENQTNKIVFIGHNLNENVLTESFQAC 372 >ref|XP_004239064.1| PREDICTED: COBW domain-containing protein 1-like [Solanum lycopersicum] Length = 371 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/38 (63%), Positives = 34/38 (89%) Frame = -3 Query: 313 YEIVPTRRWKDEENRVNKIVFIGRSLNEDILVNTLGAC 200 YEIVP+R+W++EE ++NKIVFIGR LNE+IL+++L C Sbjct: 329 YEIVPSRKWRNEEIQMNKIVFIGRFLNEEILLHSLHTC 366 >ref|XP_006348708.1| PREDICTED: COBW domain-containing protein 1-like [Solanum tuberosum] Length = 371 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -3 Query: 313 YEIVPTRRWKDEENRVNKIVFIGRSLNEDILVNTLGAC 200 YEIVP+R+W++EE ++NKIVFIGR LNE+IL+ +L C Sbjct: 329 YEIVPSRKWRNEEIQMNKIVFIGRFLNEEILLKSLHTC 366 >ref|XP_004297252.1| PREDICTED: COBW domain-containing protein 1-like [Fragaria vesca subsp. vesca] Length = 366 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 313 YEIVPTRRWKDEENRVNKIVFIGRSLNEDILVNTLGAC 200 YEIVPTR WK EEN++NKIVFIG ++NE++L AC Sbjct: 326 YEIVPTRVWKKEENQMNKIVFIGHNINENVLTQLFRAC 363 >ref|XP_002312279.1| cobalamin synthesis/P47K family protein [Populus trichocarpa] gi|222852099|gb|EEE89646.1| cobalamin synthesis/P47K family protein [Populus trichocarpa] Length = 375 Score = 56.2 bits (134), Expect = 4e-06 Identities = 21/38 (55%), Positives = 31/38 (81%) Frame = -3 Query: 313 YEIVPTRRWKDEENRVNKIVFIGRSLNEDILVNTLGAC 200 Y+IVP R+W+ +EN++NKIVFIG +L ED+L+N+ C Sbjct: 334 YDIVPARKWRSDENQINKIVFIGHNLKEDVLINSFRDC 371 >ref|XP_004168945.1| PREDICTED: COBW domain-containing protein 1-like [Cucumis sativus] Length = 367 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 313 YEIVPTRRWKDEENRVNKIVFIGRSLNEDILVNTLGAC 200 YEIVPTR+W + E++ NKIVFIGR+LNED+L T C Sbjct: 326 YEIVPTRQWNNGESQTNKIVFIGRNLNEDVLSKTFREC 363 >ref|XP_004144180.1| PREDICTED: COBW domain-containing protein 1-like [Cucumis sativus] Length = 374 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 313 YEIVPTRRWKDEENRVNKIVFIGRSLNEDILVNTLGAC 200 YEIVPTR+W + E++ NKIVFIGR+LNED+L T C Sbjct: 333 YEIVPTRQWNNGESQTNKIVFIGRNLNEDVLSKTFREC 370 >ref|XP_003516351.1| PREDICTED: COBW domain-containing protein 1-like [Glycine max] Length = 365 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -3 Query: 313 YEIVPTRRWKDEENRVNKIVFIGRSLNEDILVNT 212 YEIVP+R+W+ EE R+NKIVFIG +L EDIL+N+ Sbjct: 325 YEIVPSRKWEKEEKRINKIVFIGHNLKEDILINS 358