BLASTX nr result
ID: Rehmannia22_contig00030000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00030000 (509 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004250037.1| PREDICTED: uncharacterized protein LOC101264... 59 5e-07 ref|XP_006361704.1| PREDICTED: shugoshin-1-like isoform X5 [Sola... 57 2e-06 ref|XP_006361700.1| PREDICTED: shugoshin-1-like isoform X1 [Sola... 57 2e-06 >ref|XP_004250037.1| PREDICTED: uncharacterized protein LOC101264280 [Solanum lycopersicum] Length = 287 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 4 RYESQEFGRSSLCRPSRLAAKKVKSYREIPINVKMRRP 117 R+E FGR+SL RPSR AAK+V+SYREIP+N+KMRRP Sbjct: 249 RFEPTPFGRASLGRPSREAAKRVQSYREIPVNIKMRRP 286 >ref|XP_006361704.1| PREDICTED: shugoshin-1-like isoform X5 [Solanum tuberosum] Length = 283 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +1 Query: 4 RYESQEFGRSSLCRPSRLAAKKVKSYREIPINVKMRRP 117 R+E FGR+SL RPSR AAK+V+SY+EIP+N+KMRRP Sbjct: 245 RFEPIPFGRASLGRPSREAAKRVQSYKEIPVNIKMRRP 282 >ref|XP_006361700.1| PREDICTED: shugoshin-1-like isoform X1 [Solanum tuberosum] gi|565392009|ref|XP_006361701.1| PREDICTED: shugoshin-1-like isoform X2 [Solanum tuberosum] gi|565392011|ref|XP_006361702.1| PREDICTED: shugoshin-1-like isoform X3 [Solanum tuberosum] gi|565392013|ref|XP_006361703.1| PREDICTED: shugoshin-1-like isoform X4 [Solanum tuberosum] Length = 297 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +1 Query: 4 RYESQEFGRSSLCRPSRLAAKKVKSYREIPINVKMRRP 117 R+E FGR+SL RPSR AAK+V+SY+EIP+N+KMRRP Sbjct: 259 RFEPIPFGRASLGRPSREAAKRVQSYKEIPVNIKMRRP 296