BLASTX nr result
ID: Rehmannia22_contig00029680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00029680 (397 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152856.1| PREDICTED: nuclear speckle splicing regulato... 64 2e-08 emb|CBI28266.3| unnamed protein product [Vitis vinifera] 62 8e-08 ref|XP_002271014.1| PREDICTED: nuclear speckle splicing regulato... 62 8e-08 gb|EOY33330.1| Coiled-coil domain-containing protein 55, putativ... 60 3e-07 gb|EMJ06728.1| hypothetical protein PRUPE_ppa008496mg [Prunus pe... 55 7e-06 >ref|XP_004152856.1| PREDICTED: nuclear speckle splicing regulatory protein 1-like [Cucumis sativus] gi|449520024|ref|XP_004167034.1| PREDICTED: nuclear speckle splicing regulatory protein 1-like [Cucumis sativus] Length = 322 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 283 MKKYGLQLRVQSQQKKQPTRPPLPTPLGFNDDGDDD 390 M KYGLQLRV+ Q+KQPTRPPLP PLGF DD DDD Sbjct: 1 MSKYGLQLRVKPSQQKQPTRPPLPAPLGFQDDDDDD 36 >emb|CBI28266.3| unnamed protein product [Vitis vinifera] Length = 231 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = +1 Query: 283 MKKYGLQLRVQ-SQQKKQPTRPPLPTPLGFNDDGDDD 390 MKKYGLQLRV SQQKKQPTRPPLP PLGF D+ +DD Sbjct: 1 MKKYGLQLRVPPSQQKKQPTRPPLPPPLGFCDENEDD 37 >ref|XP_002271014.1| PREDICTED: nuclear speckle splicing regulatory protein 1 [Vitis vinifera] gi|147866225|emb|CAN79937.1| hypothetical protein VITISV_027776 [Vitis vinifera] Length = 300 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = +1 Query: 283 MKKYGLQLRVQ-SQQKKQPTRPPLPTPLGFNDDGDDD 390 MKKYGLQLRV SQQKKQPTRPPLP PLGF D+ +DD Sbjct: 1 MKKYGLQLRVPPSQQKKQPTRPPLPPPLGFCDENEDD 37 >gb|EOY33330.1| Coiled-coil domain-containing protein 55, putative isoform 1 [Theobroma cacao] gi|508786075|gb|EOY33331.1| Coiled-coil domain-containing protein 55, putative isoform 1 [Theobroma cacao] gi|508786076|gb|EOY33332.1| Coiled-coil domain-containing protein 55, putative isoform 1 [Theobroma cacao] Length = 309 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/37 (81%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = +1 Query: 283 MKKYGLQLRVQ-SQQKKQPTRPPLPTPLGFNDDGDDD 390 MKKYGLQLRV SQQKK TRPPLP PLGF DD DDD Sbjct: 1 MKKYGLQLRVPPSQQKKPVTRPPLPPPLGFRDDDDDD 37 >gb|EMJ06728.1| hypothetical protein PRUPE_ppa008496mg [Prunus persica] Length = 329 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +1 Query: 283 MKKYGLQLRVQSQQKKQPTRPPLPTPLGFNDDGDDD 390 M +YGL LR QQKKQPTRPPLP PLGF DD D+D Sbjct: 1 MSRYGLNLR--PQQKKQPTRPPLPKPLGFGDDDDND 34