BLASTX nr result
ID: Rehmannia22_contig00029537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00029537 (588 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006466504.1| PREDICTED: uncharacterized protein DDB_G0271... 59 1e-06 ref|XP_006426041.1| hypothetical protein CICLE_v10025829mg [Citr... 59 1e-06 ref|XP_006339828.1| PREDICTED: uncharacterized protein DDB_G0271... 58 2e-06 ref|XP_004231897.1| PREDICTED: uncharacterized protein LOC101253... 58 2e-06 emb|CBI33727.3| unnamed protein product [Vitis vinifera] 57 3e-06 emb|CAN76779.1| hypothetical protein VITISV_032081 [Vitis vinifera] 57 3e-06 >ref|XP_006466504.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus sinensis] Length = 384 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/53 (56%), Positives = 39/53 (73%), Gaps = 4/53 (7%) Frame = -1 Query: 147 QEDFDFCS----VSKESEMCAADEIFFQGQILPLRHSISSSEKGFCENRNGNR 1 +E+F+F S +S ESEMCAADE+FF+GQILPLR S+SS F + NG+R Sbjct: 54 EEEFNFDSWGGPLSAESEMCAADEVFFKGQILPLRLSVSSDSGLFARSENGSR 106 >ref|XP_006426041.1| hypothetical protein CICLE_v10025829mg [Citrus clementina] gi|557528031|gb|ESR39281.1| hypothetical protein CICLE_v10025829mg [Citrus clementina] Length = 384 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/53 (56%), Positives = 39/53 (73%), Gaps = 4/53 (7%) Frame = -1 Query: 147 QEDFDFCS----VSKESEMCAADEIFFQGQILPLRHSISSSEKGFCENRNGNR 1 +E+F+F S +S ESEMCAADE+FF+GQILPLR S+SS F + NG+R Sbjct: 54 EEEFNFDSWGGSLSAESEMCAADEVFFKGQILPLRLSVSSDSGLFARSENGSR 106 >ref|XP_006339828.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Solanum tuberosum] Length = 308 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/52 (59%), Positives = 38/52 (73%), Gaps = 5/52 (9%) Frame = -1 Query: 144 EDFDFCS----VSKESEMCAADEIFFQGQILPLRHSIS-SSEKGFCENRNGN 4 EDFDF S + KESEMC ADEIF++GQILPLRHSIS S++ C + N + Sbjct: 59 EDFDFSSSGGNLLKESEMCTADEIFYKGQILPLRHSISLPSDRRNCHDTNSS 110 >ref|XP_004231897.1| PREDICTED: uncharacterized protein LOC101253642 [Solanum lycopersicum] Length = 305 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/52 (59%), Positives = 38/52 (73%), Gaps = 5/52 (9%) Frame = -1 Query: 144 EDFDFCS----VSKESEMCAADEIFFQGQILPLRHSIS-SSEKGFCENRNGN 4 EDFDF S + KESEMC ADEIF++GQILPLRHSIS S++ C + N + Sbjct: 59 EDFDFSSSGGNLLKESEMCTADEIFYKGQILPLRHSISLPSDRRNCHDTNSS 110 >emb|CBI33727.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 57.4 bits (137), Expect = 3e-06 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 4/54 (7%) Frame = -1 Query: 150 TQEDFDFCSVSK----ESEMCAADEIFFQGQILPLRHSISSSEKGFCENRNGNR 1 T EDFDF S ++ ES+MCAADE+FFQGQILPLR S+ SS+ G RN +R Sbjct: 77 TGEDFDFGSWNRSLLAESDMCAADEVFFQGQILPLRLSV-SSDSGLAGYRNDSR 129 >emb|CAN76779.1| hypothetical protein VITISV_032081 [Vitis vinifera] Length = 323 Score = 57.4 bits (137), Expect = 3e-06 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 4/54 (7%) Frame = -1 Query: 150 TQEDFDFCSVSK----ESEMCAADEIFFQGQILPLRHSISSSEKGFCENRNGNR 1 T EDFDF S ++ ES+MCAADE+FFQGQILPLR S+ SS+ G RN +R Sbjct: 50 TGEDFDFGSWNRSLLAESDMCAADEVFFQGQILPLRLSV-SSDSGLAGYRNDSR 102