BLASTX nr result
ID: Rehmannia22_contig00029265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00029265 (311 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY34143.1| Myb domain protein 59 isoform 2 [Theobroma cacao] 77 2e-12 gb|EOY34142.1| Myb domain protein 48 isoform 1 [Theobroma cacao] 77 2e-12 ref|XP_004295946.1| PREDICTED: transcription factor MYB59-like [... 77 2e-12 gb|EMJ07462.1| hypothetical protein PRUPE_ppa015954mg, partial [... 77 2e-12 gb|AGZ16415.1| MYB17, partial [Scutellaria baicalensis] 77 3e-12 gb|AGZ16404.1| MYB4, partial [Scutellaria baicalensis] 77 3e-12 ref|XP_006488257.1| PREDICTED: transcription factor MYB48-like i... 76 4e-12 ref|XP_006488256.1| PREDICTED: transcription factor MYB48-like i... 76 4e-12 ref|XP_006488255.1| PREDICTED: transcription factor MYB48-like i... 76 4e-12 ref|XP_006424749.1| hypothetical protein CICLE_v10029019mg [Citr... 76 4e-12 ref|XP_006424748.1| hypothetical protein CICLE_v10029019mg [Citr... 76 4e-12 emb|CBI16189.3| unnamed protein product [Vitis vinifera] 76 4e-12 gb|ACU86962.1| MYB1-2 [Linum usitatissimum] 76 4e-12 gb|ACU86961.1| MYB1-1 [Linum usitatissimum] 76 4e-12 ref|XP_002284400.1| PREDICTED: transcription factor MYB59-like [... 76 4e-12 ref|XP_002531120.1| r2r3-myb transcription factor, putative [Ric... 76 4e-12 gb|EXC35062.1| Transcription factor [Morus notabilis] 75 9e-12 dbj|BAJ61451.1| R2R3-MYB transcription factor [Lupinus albus] 75 9e-12 gb|AHJ11179.1| MYB1-4 [Brassica juncea var. tumida] 75 1e-11 ref|NP_200786.1| transcription factor MYB59 [Arabidopsis thalian... 75 1e-11 >gb|EOY34143.1| Myb domain protein 59 isoform 2 [Theobroma cacao] Length = 247 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKK+A Sbjct: 83 NRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKRA 118 >gb|EOY34142.1| Myb domain protein 48 isoform 1 [Theobroma cacao] Length = 254 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKK+A Sbjct: 90 NRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKRA 125 >ref|XP_004295946.1| PREDICTED: transcription factor MYB59-like [Fragaria vesca subsp. vesca] Length = 260 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKK+A Sbjct: 85 NRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKRA 120 >gb|EMJ07462.1| hypothetical protein PRUPE_ppa015954mg, partial [Prunus persica] Length = 242 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKK+A Sbjct: 82 NRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKRA 117 >gb|AGZ16415.1| MYB17, partial [Scutellaria baicalensis] Length = 209 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARK+PGRTDNEIKNYWRTHMRKKAQEKKK+ Sbjct: 51 NRWSRIARKIPGRTDNEIKNYWRTHMRKKAQEKKKS 86 >gb|AGZ16404.1| MYB4, partial [Scutellaria baicalensis] Length = 214 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARK+PGRTDNEIKNYWRTHMRKKAQEKKK+ Sbjct: 50 NRWSRIARKIPGRTDNEIKNYWRTHMRKKAQEKKKS 85 >ref|XP_006488257.1| PREDICTED: transcription factor MYB48-like isoform X3 [Citrus sinensis] Length = 255 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRKKAQE+K+A Sbjct: 82 NRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRA 117 >ref|XP_006488256.1| PREDICTED: transcription factor MYB48-like isoform X2 [Citrus sinensis] Length = 256 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRKKAQE+K+A Sbjct: 83 NRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRA 118 >ref|XP_006488255.1| PREDICTED: transcription factor MYB48-like isoform X1 [Citrus sinensis] Length = 279 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRKKAQE+K+A Sbjct: 106 NRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRA 141 >ref|XP_006424749.1| hypothetical protein CICLE_v10029019mg [Citrus clementina] gi|557526683|gb|ESR37989.1| hypothetical protein CICLE_v10029019mg [Citrus clementina] Length = 255 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRKKAQE+K+A Sbjct: 82 NRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRA 117 >ref|XP_006424748.1| hypothetical protein CICLE_v10029019mg [Citrus clementina] gi|557526682|gb|ESR37988.1| hypothetical protein CICLE_v10029019mg [Citrus clementina] Length = 279 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRKKAQE+K+A Sbjct: 106 NRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRA 141 >emb|CBI16189.3| unnamed protein product [Vitis vinifera] Length = 235 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRKKAQE+K+A Sbjct: 81 NRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRA 116 >gb|ACU86962.1| MYB1-2 [Linum usitatissimum] Length = 179 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRKKAQE+K+A Sbjct: 18 NRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRA 53 >gb|ACU86961.1| MYB1-1 [Linum usitatissimum] Length = 179 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRKKAQE+K+A Sbjct: 18 NRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRA 53 >ref|XP_002284400.1| PREDICTED: transcription factor MYB59-like [Vitis vinifera] Length = 258 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRKKAQE+K+A Sbjct: 83 NRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRA 118 >ref|XP_002531120.1| r2r3-myb transcription factor, putative [Ricinus communis] gi|223529316|gb|EEF31285.1| r2r3-myb transcription factor, putative [Ricinus communis] Length = 244 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRKKAQE+K+A Sbjct: 83 NRWSRIARKLPGRTDNEIKNYWRTHMRKKAQERKRA 118 >gb|EXC35062.1| Transcription factor [Morus notabilis] Length = 299 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRK AQEKK+A Sbjct: 82 NRWSRIARKLPGRTDNEIKNYWRTHMRKTAQEKKRA 117 >dbj|BAJ61451.1| R2R3-MYB transcription factor [Lupinus albus] Length = 193 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKKA 2 +RWSRIARKLPGRTDNEIKNYWRTHMRK AQEKK+A Sbjct: 30 NRWSRIARKLPGRTDNEIKNYWRTHMRKMAQEKKRA 65 >gb|AHJ11179.1| MYB1-4 [Brassica juncea var. tumida] Length = 222 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKK 5 +RWS+IARKLPGRTDNEIKNYWRTHMRKKAQEKK+ Sbjct: 52 NRWSKIARKLPGRTDNEIKNYWRTHMRKKAQEKKR 86 >ref|NP_200786.1| transcription factor MYB59 [Arabidopsis thaliana] gi|97179947|sp|Q4JL84.2|MYB59_ARATH RecName: Full=Transcription factor MYB59; AltName: Full=Myb-related protein 59; Short=AtMYB59 gi|9758843|dbj|BAB09515.1| Myb-related transcription factor-like protein [Arabidopsis thaliana] gi|41619478|gb|AAS10111.1| MYB transcription factor [Arabidopsis thaliana] gi|332009849|gb|AED97232.1| transcription factor MYB59 [Arabidopsis thaliana] Length = 235 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -2 Query: 109 HRWSRIARKLPGRTDNEIKNYWRTHMRKKAQEKKK 5 +RWS+IARKLPGRTDNEIKNYWRTHMRKKAQEKK+ Sbjct: 83 NRWSKIARKLPGRTDNEIKNYWRTHMRKKAQEKKR 117