BLASTX nr result
ID: Rehmannia22_contig00029083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00029083 (758 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302207.1| pentatricopeptide repeat-containing family p... 61 5e-07 >ref|XP_002302207.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222843933|gb|EEE81480.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 709 Score = 60.8 bits (146), Expect = 5e-07 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +3 Query: 3 PTATMLTKIFDFSRMYKCFRLGEWASDRLNELNPLVPFRFEITDNT*F 146 PTA MLT++ D + ++C+RLGEWA+ RL+EL+P VP FEI D T F Sbjct: 659 PTAPMLTRVVDACKEHQCWRLGEWAAKRLDELSPSVPLPFEIADRTKF 706