BLASTX nr result
ID: Rehmannia22_contig00028162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00028162 (464 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ08247.1| hypothetical protein PRUPE_ppb025182mg [Prunus pe... 107 2e-21 emb|CBI39605.3| unnamed protein product [Vitis vinifera] 107 2e-21 ref|XP_002281942.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 emb|CAN61593.1| hypothetical protein VITISV_030555 [Vitis vinifera] 107 2e-21 ref|XP_006382375.1| hypothetical protein POPTR_0005s01560g [Popu... 104 1e-20 ref|XP_002330082.1| predicted protein [Populus trichocarpa] 104 1e-20 ref|XP_006433546.1| hypothetical protein CICLE_v10003403mg [Citr... 103 2e-20 ref|XP_004514991.1| PREDICTED: pentatricopeptide repeat-containi... 102 4e-20 emb|CBI16436.3| unnamed protein product [Vitis vinifera] 102 5e-20 ref|XP_002283117.1| PREDICTED: pentatricopeptide repeat-containi... 102 5e-20 emb|CAN80267.1| hypothetical protein VITISV_027683 [Vitis vinifera] 102 5e-20 ref|XP_004170418.1| PREDICTED: pentatricopeptide repeat-containi... 102 7e-20 ref|XP_004135765.1| PREDICTED: pentatricopeptide repeat-containi... 102 7e-20 gb|EOY07940.1| Tetratricopeptide repeat-like superfamily protein... 101 9e-20 ref|XP_006854804.1| hypothetical protein AMTR_s00063p00172440 [A... 100 2e-19 ref|XP_004158687.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 100 2e-19 ref|XP_004134903.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 ref|XP_003619636.1| Pentatricopeptide repeat-containing protein ... 100 2e-19 ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_003557645.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 >gb|EMJ08247.1| hypothetical protein PRUPE_ppb025182mg [Prunus persica] Length = 672 Score = 107 bits (266), Expect = 2e-21 Identities = 45/57 (78%), Positives = 52/57 (91%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NT+PG TIRV KNLR C DCHSAIKI S+VYER+IIVRDR+RYHHF++G+CSCKDFW Sbjct: 616 NTKPGTTIRVTKNLRTCEDCHSAIKIFSKVYERDIIVRDRMRYHHFRNGRCSCKDFW 672 >emb|CBI39605.3| unnamed protein product [Vitis vinifera] Length = 624 Score = 107 bits (266), Expect = 2e-21 Identities = 45/57 (78%), Positives = 51/57 (89%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NT PG TIR+VKNLRVC DCHSA K+IS+VY REIIVRDR+RYHHF++G CSCKDFW Sbjct: 568 NTSPGTTIRIVKNLRVCEDCHSATKLISQVYNREIIVRDRIRYHHFRNGACSCKDFW 624 >ref|XP_002281942.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910 isoform 1 [Vitis vinifera] Length = 672 Score = 107 bits (266), Expect = 2e-21 Identities = 45/57 (78%), Positives = 51/57 (89%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NT PG TIR+VKNLRVC DCHSA K+IS+VY REIIVRDR+RYHHF++G CSCKDFW Sbjct: 616 NTSPGTTIRIVKNLRVCEDCHSATKLISQVYNREIIVRDRIRYHHFRNGACSCKDFW 672 >emb|CAN61593.1| hypothetical protein VITISV_030555 [Vitis vinifera] Length = 673 Score = 107 bits (266), Expect = 2e-21 Identities = 45/57 (78%), Positives = 51/57 (89%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NT PG TIR+VKNLRVC DCHSA K+IS+VY REIIVRDR+RYHHF++G CSCKDFW Sbjct: 617 NTSPGTTIRIVKNLRVCEDCHSATKLISQVYNREIIVRDRIRYHHFRNGACSCKDFW 673 >ref|XP_006382375.1| hypothetical protein POPTR_0005s01560g [Populus trichocarpa] gi|550337735|gb|ERP60172.1| hypothetical protein POPTR_0005s01560g [Populus trichocarpa] Length = 545 Score = 104 bits (260), Expect = 1e-20 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NT+PG TI VVKNLR+C DCHSA K+IS+VY+REIIVRDR RYHHFK G CSCKDFW Sbjct: 489 NTKPGTTIHVVKNLRMCEDCHSAFKLISQVYDREIIVRDRARYHHFKTGTCSCKDFW 545 >ref|XP_002330082.1| predicted protein [Populus trichocarpa] Length = 665 Score = 104 bits (260), Expect = 1e-20 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NT+PG TI VVKNLR+C DCHSA K+IS+VY+REIIVRDR RYHHFK G CSCKDFW Sbjct: 609 NTKPGTTIHVVKNLRMCEDCHSAFKLISQVYDREIIVRDRARYHHFKTGTCSCKDFW 665 >ref|XP_006433546.1| hypothetical protein CICLE_v10003403mg [Citrus clementina] gi|557535668|gb|ESR46786.1| hypothetical protein CICLE_v10003403mg [Citrus clementina] Length = 558 Score = 103 bits (257), Expect = 2e-20 Identities = 43/57 (75%), Positives = 52/57 (91%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NT PGATIRV+KNLRVC DCHSA K+I +V++R+IIVRDRVRYHHF++G+CSC DFW Sbjct: 502 NTNPGATIRVIKNLRVCEDCHSATKLIFKVFKRDIIVRDRVRYHHFRNGKCSCNDFW 558 >ref|XP_004514991.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Cicer arietinum] Length = 690 Score = 102 bits (255), Expect = 4e-20 Identities = 43/57 (75%), Positives = 48/57 (84%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NTEPG IR+VKNLRVCGDCH A K IS+VY+R I+VRDR RYHHFK G CSCKD+W Sbjct: 634 NTEPGTPIRIVKNLRVCGDCHQATKFISKVYDRVIVVRDRTRYHHFKDGICSCKDYW 690 >emb|CBI16436.3| unnamed protein product [Vitis vinifera] Length = 545 Score = 102 bits (254), Expect = 5e-20 Identities = 43/57 (75%), Positives = 48/57 (84%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NT PG IR+VKNLRVC DCH A K IS+VY+REIIVRDR+RYHHFK G CSCKD+W Sbjct: 489 NTPPGTAIRIVKNLRVCADCHEATKFISKVYKREIIVRDRIRYHHFKDGFCSCKDYW 545 >ref|XP_002283117.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 624 Score = 102 bits (254), Expect = 5e-20 Identities = 43/57 (75%), Positives = 48/57 (84%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NT PG IR+VKNLRVC DCH A K IS+VY+REIIVRDR+RYHHFK G CSCKD+W Sbjct: 568 NTPPGTAIRIVKNLRVCADCHEATKFISKVYKREIIVRDRIRYHHFKDGFCSCKDYW 624 >emb|CAN80267.1| hypothetical protein VITISV_027683 [Vitis vinifera] Length = 539 Score = 102 bits (254), Expect = 5e-20 Identities = 43/57 (75%), Positives = 48/57 (84%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NT PG IR+VKNLRVC DCH A K IS+VY+REIIVRDR+RYHHFK G CSCKD+W Sbjct: 483 NTPPGTAIRIVKNLRVCADCHEATKFISKVYKREIIVRDRIRYHHFKDGFCSCKDYW 539 >ref|XP_004170418.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Cucumis sativus] Length = 666 Score = 102 bits (253), Expect = 7e-20 Identities = 43/57 (75%), Positives = 50/57 (87%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NT PG I +VKNLRVC DCHSA K+IS++++REIIVRDRVRYHHFK+G CSCKDFW Sbjct: 610 NTLPGKRIHIVKNLRVCDDCHSATKLISQIFDREIIVRDRVRYHHFKNGTCSCKDFW 666 >ref|XP_004135765.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Cucumis sativus] Length = 666 Score = 102 bits (253), Expect = 7e-20 Identities = 43/57 (75%), Positives = 50/57 (87%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NT PG I +VKNLRVC DCHSA K+IS++++REIIVRDRVRYHHFK+G CSCKDFW Sbjct: 610 NTLPGKRIHIVKNLRVCDDCHSATKLISQIFDREIIVRDRVRYHHFKNGTCSCKDFW 666 >gb|EOY07940.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 756 Score = 101 bits (252), Expect = 9e-20 Identities = 40/57 (70%), Positives = 49/57 (85%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 N PG T+R++KNLRVCGDCHSA K++S +Y REIIVRD +R+HHFK+G CSCKDFW Sbjct: 700 NASPGETLRIMKNLRVCGDCHSAFKLLSEMYRREIIVRDAIRFHHFKNGSCSCKDFW 756 >ref|XP_006854804.1| hypothetical protein AMTR_s00063p00172440 [Amborella trichopoda] gi|548858508|gb|ERN16271.1| hypothetical protein AMTR_s00063p00172440 [Amborella trichopoda] Length = 914 Score = 100 bits (249), Expect = 2e-19 Identities = 43/57 (75%), Positives = 47/57 (82%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 N PG+TIRV KNLRVCGDCHSA K IS+V EREI+VRD RYHHF+ G CSCKDFW Sbjct: 858 NAPPGSTIRVFKNLRVCGDCHSATKFISKVMEREIVVRDAYRYHHFRDGSCSCKDFW 914 >ref|XP_004158687.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] Length = 609 Score = 100 bits (249), Expect = 2e-19 Identities = 42/57 (73%), Positives = 49/57 (85%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NT PG IR++KNLRVC DCH AIK+IS+V+EREIIVRDR R+HHFK G CSCKD+W Sbjct: 553 NTPPGTPIRIMKNLRVCADCHLAIKLISKVFEREIIVRDRSRFHHFKDGSCSCKDYW 609 >ref|XP_004134903.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cucumis sativus] Length = 609 Score = 100 bits (249), Expect = 2e-19 Identities = 42/57 (73%), Positives = 49/57 (85%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NT PG IR++KNLRVC DCH AIK+IS+V+EREIIVRDR R+HHFK G CSCKD+W Sbjct: 553 NTPPGTPIRIMKNLRVCADCHLAIKLISKVFEREIIVRDRSRFHHFKDGSCSCKDYW 609 >ref|XP_003619636.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355494651|gb|AES75854.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 403 Score = 100 bits (249), Expect = 2e-19 Identities = 43/57 (75%), Positives = 48/57 (84%) Frame = -3 Query: 462 NTEPGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 NT PG I +VKNLRVCGDCH AIK IS+VY+R IIVRDR+RYHHFK G CSCKD+W Sbjct: 347 NTAPGTPICIVKNLRVCGDCHEAIKFISKVYDRVIIVRDRMRYHHFKDGVCSCKDYW 403 >ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Setaria italica] Length = 594 Score = 100 bits (248), Expect = 3e-19 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -3 Query: 453 PGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 PG IR+VKNLRVCGDCH AIK+IS++Y+REIIVRDR R+HHFK G CSCKD+W Sbjct: 541 PGTPIRIVKNLRVCGDCHMAIKLISKIYDREIIVRDRSRFHHFKGGSCSCKDYW 594 >ref|XP_003557645.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Brachypodium distachyon] Length = 598 Score = 100 bits (248), Expect = 3e-19 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = -3 Query: 453 PGATIRVVKNLRVCGDCHSAIKIISRVYEREIIVRDRVRYHHFKHGQCSCKDFW 292 PG IR+VKNLRVCGDCH AIK+IS+VY+REIIVRDR R+HHFK G CSCKD+W Sbjct: 545 PGTPIRIVKNLRVCGDCHMAIKLISKVYDREIIVRDRSRFHHFKGGACSCKDYW 598