BLASTX nr result
ID: Rehmannia22_contig00028147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00028147 (560 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADN34235.1| hypothetical protein [Cucumis melo subsp. melo] 55 9e-06 >gb|ADN34235.1| hypothetical protein [Cucumis melo subsp. melo] Length = 51 Score = 55.5 bits (132), Expect = 9e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 92 CLTYIVAEVTNCKQADIDFRGHEEIFSEHG 3 CLTYIVAEVTNCKQA+ID R HEEI+SE G Sbjct: 2 CLTYIVAEVTNCKQANIDIREHEEIYSEPG 31