BLASTX nr result
ID: Rehmannia22_contig00028038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00028038 (466 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAZ94630.1| zinc finger protein-like protein [Gossypium hirsu... 96 6e-18 gb|EPS67945.1| hypothetical protein M569_06829 [Genlisea aurea] 94 2e-17 ref|XP_006298699.1| hypothetical protein CARUB_v10014794mg [Caps... 94 2e-17 ref|XP_006361516.1| PREDICTED: uncharacterized RNA-binding prote... 93 4e-17 ref|XP_004245200.1| PREDICTED: zinc finger Ran-binding domain-co... 93 4e-17 ref|NP_188189.1| Ran BP2/NZF zinc finger-like protein [Arabidops... 93 4e-17 gb|AAM66130.1| putative zinc finger protein [Arabidopsis thaliana] 93 4e-17 ref|XP_006465374.1| PREDICTED: uncharacterized RNA-binding prote... 92 5e-17 ref|XP_006427203.1| hypothetical protein CICLE_v10026703mg [Citr... 92 5e-17 gb|EOY26527.1| Ran BP2/NZF zinc finger-like superfamily protein ... 92 7e-17 ref|XP_006361517.1| PREDICTED: uncharacterized RNA-binding prote... 92 9e-17 ref|XP_002299606.1| zinc finger family protein [Populus trichoca... 92 9e-17 ref|XP_002882957.1| zinc finger (Ran-binding) family protein [Ar... 91 1e-16 ref|XP_006406934.1| hypothetical protein EUTSA_v10021670mg [Eutr... 91 2e-16 ref|XP_002285376.1| PREDICTED: uncharacterized RNA-binding prote... 90 4e-16 ref|XP_002517589.1| protein with unknown function [Ricinus commu... 89 5e-16 ref|XP_002304153.1| zinc finger family protein [Populus trichoca... 88 1e-15 gb|EXC26040.1| Uncharacterized RNA-binding protein [Morus notabi... 88 1e-15 gb|ADK63398.1| Ran-binding zinc finger protein [Brassica rapa] 88 1e-15 gb|EMJ16293.1| hypothetical protein PRUPE_ppa012687mg [Prunus pe... 87 2e-15 >gb|AAZ94630.1| zinc finger protein-like protein [Gossypium hirsutum] Length = 139 Score = 95.5 bits (236), Expect = 6e-18 Identities = 38/45 (84%), Positives = 45/45 (100%) Frame = -1 Query: 466 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSSF 332 GG+RSGWKSGDWICTRLGCNEHNFASRMECFRC+APREF++++S+ Sbjct: 95 GGNRSGWKSGDWICTRLGCNEHNFASRMECFRCSAPREFNNRTSY 139 >gb|EPS67945.1| hypothetical protein M569_06829 [Genlisea aurea] Length = 163 Score = 94.0 bits (232), Expect = 2e-17 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = -1 Query: 466 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSSF 332 GGSRS WKSGDWICTRLGCNEHNFASRMECFRCNAPRE + KS F Sbjct: 119 GGSRSSWKSGDWICTRLGCNEHNFASRMECFRCNAPRESTGKSVF 163 >ref|XP_006298699.1| hypothetical protein CARUB_v10014794mg [Capsella rubella] gi|482567408|gb|EOA31597.1| hypothetical protein CARUB_v10014794mg [Capsella rubella] Length = 165 Score = 93.6 bits (231), Expect = 2e-17 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -1 Query: 463 GSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSSF 332 G RS WKSGDWICTRLGCNEHNFASRMECFRCNAPR+FS+++SF Sbjct: 122 GGRSSWKSGDWICTRLGCNEHNFASRMECFRCNAPRDFSNRTSF 165 >ref|XP_006361516.1| PREDICTED: uncharacterized RNA-binding protein C17H9.04c-like isoform X1 [Solanum tuberosum] gi|565391618|ref|XP_006361518.1| PREDICTED: uncharacterized RNA-binding protein C17H9.04c-like isoform X3 [Solanum tuberosum] Length = 172 Score = 92.8 bits (229), Expect = 4e-17 Identities = 40/46 (86%), Positives = 44/46 (95%), Gaps = 1/46 (2%) Frame = -1 Query: 466 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFS-SKSSF 332 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPR+ + +KSS+ Sbjct: 127 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPRDLAGNKSSY 172 >ref|XP_004245200.1| PREDICTED: zinc finger Ran-binding domain-containing protein 2-like [Solanum lycopersicum] Length = 170 Score = 92.8 bits (229), Expect = 4e-17 Identities = 40/46 (86%), Positives = 44/46 (95%), Gaps = 1/46 (2%) Frame = -1 Query: 466 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFS-SKSSF 332 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPR+ + +KSS+ Sbjct: 125 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPRDLAGNKSSY 170 >ref|NP_188189.1| Ran BP2/NZF zinc finger-like protein [Arabidopsis thaliana] gi|11994340|dbj|BAB02299.1| zinc finger protein-like; Ser/Thr protein kinase-like protein [Arabidopsis thaliana] gi|89274153|gb|ABD65597.1| At3g15680 [Arabidopsis thaliana] gi|332642192|gb|AEE75713.1| Ran BP2/NZF zinc finger-like protein [Arabidopsis thaliana] Length = 164 Score = 92.8 bits (229), Expect = 4e-17 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 463 GSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSSF 332 G RS WKSGDWICTR+GCNEHNFASRMECFRCNAPR+FS+++SF Sbjct: 121 GGRSSWKSGDWICTRIGCNEHNFASRMECFRCNAPRDFSNRTSF 164 >gb|AAM66130.1| putative zinc finger protein [Arabidopsis thaliana] Length = 164 Score = 92.8 bits (229), Expect = 4e-17 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 463 GSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSSF 332 G RS WKSGDWICTR+GCNEHNFASRMECFRCNAPR+FS+++SF Sbjct: 121 GGRSSWKSGDWICTRIGCNEHNFASRMECFRCNAPRDFSNRTSF 164 >ref|XP_006465374.1| PREDICTED: uncharacterized RNA-binding protein C17H9.04c-like [Citrus sinensis] Length = 151 Score = 92.4 bits (228), Expect = 5e-17 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -1 Query: 466 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSSF 332 GG+RSGWKSGDWICTR GCNEHNFASRMECFRCNAPR+F ++ S+ Sbjct: 107 GGNRSGWKSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 151 >ref|XP_006427203.1| hypothetical protein CICLE_v10026703mg [Citrus clementina] gi|557529193|gb|ESR40443.1| hypothetical protein CICLE_v10026703mg [Citrus clementina] Length = 151 Score = 92.4 bits (228), Expect = 5e-17 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -1 Query: 466 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSSF 332 GG+RSGWKSGDWICTR GCNEHNFASRMECFRCNAPR+F ++ S+ Sbjct: 107 GGNRSGWKSGDWICTRSGCNEHNFASRMECFRCNAPRDFGNRISY 151 >gb|EOY26527.1| Ran BP2/NZF zinc finger-like superfamily protein isoform 1 [Theobroma cacao] gi|508779272|gb|EOY26528.1| Ran BP2/NZF zinc finger-like superfamily protein isoform 1 [Theobroma cacao] Length = 145 Score = 92.0 bits (227), Expect = 7e-17 Identities = 36/45 (80%), Positives = 44/45 (97%) Frame = -1 Query: 466 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSSF 332 GG+RSGWKSGDWICTR GCNEHNFASRMECFRC+APR+F++++S+ Sbjct: 101 GGNRSGWKSGDWICTRSGCNEHNFASRMECFRCSAPRDFNNRTSY 145 >ref|XP_006361517.1| PREDICTED: uncharacterized RNA-binding protein C17H9.04c-like isoform X2 [Solanum tuberosum] Length = 170 Score = 91.7 bits (226), Expect = 9e-17 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 466 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKS 338 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPR+ + S Sbjct: 127 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPRDLAGVS 169 >ref|XP_002299606.1| zinc finger family protein [Populus trichocarpa] gi|118483479|gb|ABK93638.1| unknown [Populus trichocarpa] gi|222846864|gb|EEE84411.1| zinc finger family protein [Populus trichocarpa] Length = 151 Score = 91.7 bits (226), Expect = 9e-17 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -1 Query: 466 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSSF 332 GG+RSGWKSGDWICTR GCNEHNFASRMECF+CNAPR+ S+++S+ Sbjct: 107 GGNRSGWKSGDWICTRWGCNEHNFASRMECFKCNAPRDLSNRTSY 151 >ref|XP_002882957.1| zinc finger (Ran-binding) family protein [Arabidopsis lyrata subsp. lyrata] gi|297328797|gb|EFH59216.1| zinc finger (Ran-binding) family protein [Arabidopsis lyrata subsp. lyrata] Length = 164 Score = 91.3 bits (225), Expect = 1e-16 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = -1 Query: 463 GSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSSF 332 G RS WKSGDWICTR+GCNEHNFASR+ECFRCNAPR+FS+++SF Sbjct: 121 GGRSSWKSGDWICTRIGCNEHNFASRIECFRCNAPRDFSNRTSF 164 >ref|XP_006406934.1| hypothetical protein EUTSA_v10021670mg [Eutrema salsugineum] gi|557108080|gb|ESQ48387.1| hypothetical protein EUTSA_v10021670mg [Eutrema salsugineum] Length = 164 Score = 90.5 bits (223), Expect = 2e-16 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -1 Query: 457 RSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSSF 332 RS WKSGDWICTR+GCNEHNFASRMECFRCNAPR+FS+++SF Sbjct: 123 RSSWKSGDWICTRIGCNEHNFASRMECFRCNAPRDFSNRTSF 164 >ref|XP_002285376.1| PREDICTED: uncharacterized RNA-binding protein C17H9.04c [Vitis vinifera] gi|297743402|emb|CBI36269.3| unnamed protein product [Vitis vinifera] Length = 150 Score = 89.7 bits (221), Expect = 4e-16 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -1 Query: 466 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSSF 332 G RSGWKSGDWIC+R GCNEHNFASRMECFRCNAPR+ S+K+S+ Sbjct: 106 GSGRSGWKSGDWICSRSGCNEHNFASRMECFRCNAPRDLSNKTSY 150 >ref|XP_002517589.1| protein with unknown function [Ricinus communis] gi|223543221|gb|EEF44753.1| protein with unknown function [Ricinus communis] Length = 152 Score = 89.4 bits (220), Expect = 5e-16 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -1 Query: 466 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSSF 332 G +RSGWKSGDWICTR GCNEHNFASRMECF+CNAPRE S+++++ Sbjct: 108 GSNRSGWKSGDWICTRWGCNEHNFASRMECFKCNAPRELSNRTTY 152 >ref|XP_002304153.1| zinc finger family protein [Populus trichocarpa] gi|566161098|ref|XP_006385496.1| hypothetical protein POPTR_0003s05990g [Populus trichocarpa] gi|222841585|gb|EEE79132.1| zinc finger family protein [Populus trichocarpa] gi|550342511|gb|ERP63293.1| hypothetical protein POPTR_0003s05990g [Populus trichocarpa] Length = 151 Score = 88.2 bits (217), Expect = 1e-15 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -1 Query: 466 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSSF 332 G +RSGWKSGDWICTR GCNEHNFASRMECF+CNAPR+ S+ +S+ Sbjct: 107 GSNRSGWKSGDWICTRWGCNEHNFASRMECFKCNAPRDLSNTTSY 151 >gb|EXC26040.1| Uncharacterized RNA-binding protein [Morus notabilis] Length = 162 Score = 87.8 bits (216), Expect = 1e-15 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -1 Query: 466 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSS 335 G SRSGWKSGDWICTR GCNEHNFASRMECFRCNAPR+ S+ S Sbjct: 116 GSSRSGWKSGDWICTRSGCNEHNFASRMECFRCNAPRDSSTGKS 159 >gb|ADK63398.1| Ran-binding zinc finger protein [Brassica rapa] Length = 163 Score = 87.8 bits (216), Expect = 1e-15 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 457 RSGWKSGDWICTRLGCNEHNFASRMECFRCNAPREFSSKSSF 332 RS WKSGDWICTR+GCNEHNFASRMECFRCNAPR+FS+ S F Sbjct: 122 RSSWKSGDWICTRIGCNEHNFASRMECFRCNAPRDFSNGSFF 163 >gb|EMJ16293.1| hypothetical protein PRUPE_ppa012687mg [Prunus persica] Length = 158 Score = 87.4 bits (215), Expect = 2e-15 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 466 GGSRSGWKSGDWICTRLGCNEHNFASRMECFRCNAPRE 353 GG+R GWKSGDWICTRLGCNEHNFASRMECFRCNAPR+ Sbjct: 119 GGARPGWKSGDWICTRLGCNEHNFASRMECFRCNAPRD 156