BLASTX nr result
ID: Rehmannia22_contig00027899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00027899 (349 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY03600.1| Pentatricopeptide repeat superfamily protein, put... 57 3e-06 >gb|EOY03600.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] gi|508711704|gb|EOY03601.1| Pentatricopeptide repeat superfamily protein, putative isoform 1 [Theobroma cacao] Length = 619 Score = 56.6 bits (135), Expect = 3e-06 Identities = 45/119 (37%), Positives = 58/119 (48%), Gaps = 11/119 (9%) Frame = -2 Query: 324 SIEIKSPCVMEEEKIPIFEGMEVFSENCPQQILPPWGNLS-DQDLEEDE----------N 178 SIE + C +EE I I +G E F + Q LPPWGNL D+ L+ + N Sbjct: 100 SIESEMDCEDDEENILIQKGKEEFGLDSLGQNLPPWGNLVVDESLDFEHTSVGQPAISSN 159 Query: 177 HLDNRSEISVKPIHETGXXXXXXXXXXXXXLSKRILELSRSNKVRSALSLYKSMVFSSL 1 D+ + V + ET S+R+L LSRSNKVRSAL L +SM S L Sbjct: 160 GKDSVHDSKVHFLEETNEEEL----------SRRVLMLSRSNKVRSALELCRSMKLSGL 208