BLASTX nr result
ID: Rehmannia22_contig00027235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00027235 (325 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT32289.1| Two-component response regulator-like PRR73 [Aegi... 57 3e-06 >gb|EMT32289.1| Two-component response regulator-like PRR73 [Aegilops tauschii] Length = 763 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -3 Query: 275 VRYQTRKRLAEQRPRVRGQFVKQTGTDSSNRSED 174 VRYQ+RKRLAEQRPRVRGQFV+Q+G D + ++ED Sbjct: 729 VRYQSRKRLAEQRPRVRGQFVRQSGQDEAGQAED 762