BLASTX nr result
ID: Rehmannia22_contig00027056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00027056 (573 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525577.1| conserved hypothetical protein [Ricinus comm... 105 1e-20 ref|XP_002264033.2| PREDICTED: uncharacterized protein LOC100263... 103 4e-20 emb|CBI40627.3| unnamed protein product [Vitis vinifera] 103 4e-20 ref|XP_002266876.2| PREDICTED: uncharacterized protein LOC100249... 103 4e-20 emb|CBI25812.3| unnamed protein product [Vitis vinifera] 103 4e-20 ref|XP_002272522.1| PREDICTED: uncharacterized protein LOC100250... 103 4e-20 emb|CAN84094.1| hypothetical protein VITISV_022547 [Vitis vinifera] 103 4e-20 ref|XP_003634894.1| PREDICTED: uncharacterized protein LOC100853... 101 1e-19 emb|CBI25807.3| unnamed protein product [Vitis vinifera] 101 1e-19 ref|XP_002275894.2| PREDICTED: uncharacterized protein LOC100264... 101 2e-19 emb|CBI40640.3| unnamed protein product [Vitis vinifera] 101 2e-19 ref|XP_006361183.1| PREDICTED: uncharacterized protein LOC102578... 100 3e-19 ref|XP_006361180.1| PREDICTED: uncharacterized protein LOC102578... 100 3e-19 ref|XP_004241967.1| PREDICTED: uncharacterized protein LOC101268... 100 3e-19 gb|EOY19515.1| Uncharacterized protein isoform 2 [Theobroma cacao] 100 4e-19 ref|XP_006432331.1| hypothetical protein CICLE_v10002366mg [Citr... 98 1e-18 ref|XP_006432330.1| hypothetical protein CICLE_v10002366mg [Citr... 98 1e-18 ref|XP_004516534.1| PREDICTED: uncharacterized protein LOC101500... 98 2e-18 ref|XP_004516532.1| PREDICTED: uncharacterized protein LOC101500... 98 2e-18 ref|XP_004516531.1| PREDICTED: uncharacterized protein LOC101500... 98 2e-18 >ref|XP_002525577.1| conserved hypothetical protein [Ricinus communis] gi|223535156|gb|EEF36836.1| conserved hypothetical protein [Ricinus communis] Length = 237 Score = 105 bits (261), Expect = 1e-20 Identities = 48/58 (82%), Positives = 55/58 (94%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KLIRAGGALALAPFVDRGLSWFT+KF F+SQGKAF+AI GFC GLAF++F++VTLLWA Sbjct: 180 KLIRAGGALALAPFVDRGLSWFTLKFKFESQGKAFMAIVGFCLGLAFILFLVVTLLWA 237 >ref|XP_002264033.2| PREDICTED: uncharacterized protein LOC100263253 [Vitis vinifera] Length = 125 Score = 103 bits (256), Expect = 4e-20 Identities = 48/58 (82%), Positives = 53/58 (91%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL+RAGGALALAP VDRGLSWFTVKF F+SQGKAF+AI GFCFGLA ++F IVTLLWA Sbjct: 68 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 125 >emb|CBI40627.3| unnamed protein product [Vitis vinifera] Length = 82 Score = 103 bits (256), Expect = 4e-20 Identities = 48/58 (82%), Positives = 53/58 (91%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL+RAGGALALAP VDRGLSWFTVKF F+SQGKAF+AI GFCFGLA ++F IVTLLWA Sbjct: 25 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 82 >ref|XP_002266876.2| PREDICTED: uncharacterized protein LOC100249912 [Vitis vinifera] gi|298205097|emb|CBI40618.3| unnamed protein product [Vitis vinifera] Length = 153 Score = 103 bits (256), Expect = 4e-20 Identities = 48/58 (82%), Positives = 53/58 (91%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL+RAGGALALAP VDRGLSWFTVKF F+SQGKAF+AI GFCFGLA ++F IVTLLWA Sbjct: 96 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 153 >emb|CBI25812.3| unnamed protein product [Vitis vinifera] Length = 213 Score = 103 bits (256), Expect = 4e-20 Identities = 48/58 (82%), Positives = 53/58 (91%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL+RAGGALALAP VDRGLSWFTVKF F+SQGKAF+AI GFCFGLA ++F IVTLLWA Sbjct: 156 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 213 >ref|XP_002272522.1| PREDICTED: uncharacterized protein LOC100250564 [Vitis vinifera] Length = 215 Score = 103 bits (256), Expect = 4e-20 Identities = 48/58 (82%), Positives = 53/58 (91%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL+RAGGALALAP VDRGLSWFTVKF F+SQGKAF+AI GFCFGLA ++F IVTLLWA Sbjct: 158 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 215 >emb|CAN84094.1| hypothetical protein VITISV_022547 [Vitis vinifera] Length = 132 Score = 103 bits (256), Expect = 4e-20 Identities = 48/58 (82%), Positives = 53/58 (91%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL+RAGGALALAP VDRGLSWFTVKF F+SQGKAF+AI GFCFGLA ++F IVTLLWA Sbjct: 75 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 132 >ref|XP_003634894.1| PREDICTED: uncharacterized protein LOC100853368 [Vitis vinifera] Length = 125 Score = 101 bits (252), Expect = 1e-19 Identities = 47/58 (81%), Positives = 52/58 (89%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL+RAGGALALAP VDRGLSWFT+KF F+SQGKAF AI GFCFGLA ++F IVTLLWA Sbjct: 68 KLVRAGGALALAPIVDRGLSWFTLKFKFESQGKAFTAIVGFCFGLALILFFIVTLLWA 125 >emb|CBI25807.3| unnamed protein product [Vitis vinifera] Length = 153 Score = 101 bits (252), Expect = 1e-19 Identities = 47/58 (81%), Positives = 52/58 (89%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL+RAGGALALAP VDRGLSWFT+KF F+SQGKAF AI GFCFGLA ++F IVTLLWA Sbjct: 96 KLVRAGGALALAPIVDRGLSWFTLKFKFESQGKAFTAIVGFCFGLALILFFIVTLLWA 153 >ref|XP_002275894.2| PREDICTED: uncharacterized protein LOC100264237 [Vitis vinifera] Length = 121 Score = 101 bits (251), Expect = 2e-19 Identities = 47/58 (81%), Positives = 52/58 (89%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL+RAGGALALAP VDRGLSWFTVKF F+SQGK F+AI GFCFGLA ++F IVTLLWA Sbjct: 64 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKPFMAIVGFCFGLALILFFIVTLLWA 121 >emb|CBI40640.3| unnamed protein product [Vitis vinifera] Length = 153 Score = 101 bits (251), Expect = 2e-19 Identities = 47/58 (81%), Positives = 52/58 (89%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL+RAGGALALAP VDRGLSWFTVKF F+SQGK F+AI GFCFGLA ++F IVTLLWA Sbjct: 96 KLVRAGGALALAPIVDRGLSWFTVKFKFESQGKPFMAIVGFCFGLALILFFIVTLLWA 153 >ref|XP_006361183.1| PREDICTED: uncharacterized protein LOC102578377 isoform X4 [Solanum tuberosum] Length = 179 Score = 100 bits (249), Expect = 3e-19 Identities = 44/58 (75%), Positives = 52/58 (89%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 K++RAGGALALAPFVD GLSWFT K F+SQGKAF +AGFCFGLAF++F+I+TLLWA Sbjct: 122 KIVRAGGALALAPFVDTGLSWFTTKMKFESQGKAFAVVAGFCFGLAFMLFLIITLLWA 179 >ref|XP_006361180.1| PREDICTED: uncharacterized protein LOC102578377 isoform X1 [Solanum tuberosum] gi|565390921|ref|XP_006361181.1| PREDICTED: uncharacterized protein LOC102578377 isoform X2 [Solanum tuberosum] Length = 213 Score = 100 bits (249), Expect = 3e-19 Identities = 44/58 (75%), Positives = 52/58 (89%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 K++RAGGALALAPFVD GLSWFT K F+SQGKAF +AGFCFGLAF++F+I+TLLWA Sbjct: 156 KIVRAGGALALAPFVDTGLSWFTTKMKFESQGKAFAVVAGFCFGLAFMLFLIITLLWA 213 >ref|XP_004241967.1| PREDICTED: uncharacterized protein LOC101268479 [Solanum lycopersicum] Length = 210 Score = 100 bits (248), Expect = 3e-19 Identities = 45/58 (77%), Positives = 51/58 (87%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 K++RAGGALALAPFVD GLSWFT K FKSQGKAF +AGFCF LAF++F+IVTLLWA Sbjct: 153 KIVRAGGALALAPFVDTGLSWFTTKMKFKSQGKAFAVVAGFCFSLAFMLFLIVTLLWA 210 >gb|EOY19515.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 243 Score = 99.8 bits (247), Expect = 4e-19 Identities = 45/58 (77%), Positives = 53/58 (91%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL+RAGGALALAPFVDR LSWFTVKF F+SQGKA + I GFCFGLAF++F++VT+LWA Sbjct: 186 KLVRAGGALALAPFVDRALSWFTVKFKFESQGKASMVIIGFCFGLAFMLFLVVTVLWA 243 >ref|XP_006432331.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] gi|557534453|gb|ESR45571.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] Length = 221 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL+RA GALALAP VDRGLSWFTVKF F++QGKAF+AI GFCFGLA ++F+ VTLLWA Sbjct: 164 KLVRAAGALALAPLVDRGLSWFTVKFKFQTQGKAFMAIVGFCFGLAVILFLAVTLLWA 221 >ref|XP_006432330.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] gi|568834248|ref|XP_006471257.1| PREDICTED: uncharacterized protein LOC102618398 [Citrus sinensis] gi|557534452|gb|ESR45570.1| hypothetical protein CICLE_v10002366mg [Citrus clementina] Length = 230 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL+RA GALALAP VDRGLSWFTVKF F++QGKAF+AI GFCFGLA ++F+ VTLLWA Sbjct: 173 KLVRAAGALALAPLVDRGLSWFTVKFKFQTQGKAFMAIVGFCFGLAVILFLAVTLLWA 230 >ref|XP_004516534.1| PREDICTED: uncharacterized protein LOC101500524 isoform X6 [Cicer arietinum] Length = 154 Score = 97.8 bits (242), Expect = 2e-18 Identities = 44/58 (75%), Positives = 52/58 (89%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL RA GALA+APFVDRGLSWFT KF F+SQGKAF+AI GFCFGLA ++F+++TLLWA Sbjct: 97 KLARAAGALAMAPFVDRGLSWFTDKFKFQSQGKAFMAIVGFCFGLALIVFLVITLLWA 154 >ref|XP_004516532.1| PREDICTED: uncharacterized protein LOC101500524 isoform X4 [Cicer arietinum] Length = 217 Score = 97.8 bits (242), Expect = 2e-18 Identities = 44/58 (75%), Positives = 52/58 (89%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL RA GALA+APFVDRGLSWFT KF F+SQGKAF+AI GFCFGLA ++F+++TLLWA Sbjct: 160 KLARAAGALAMAPFVDRGLSWFTDKFKFQSQGKAFMAIVGFCFGLALIVFLVITLLWA 217 >ref|XP_004516531.1| PREDICTED: uncharacterized protein LOC101500524 isoform X3 [Cicer arietinum] Length = 219 Score = 97.8 bits (242), Expect = 2e-18 Identities = 44/58 (75%), Positives = 52/58 (89%) Frame = -2 Query: 572 KLIRAGGALALAPFVDRGLSWFTVKFGFKSQGKAFVAIAGFCFGLAFLMFVIVTLLWA 399 KL RA GALA+APFVDRGLSWFT KF F+SQGKAF+AI GFCFGLA ++F+++TLLWA Sbjct: 162 KLARAAGALAMAPFVDRGLSWFTDKFKFQSQGKAFMAIVGFCFGLALIVFLVITLLWA 219