BLASTX nr result
ID: Rehmannia22_contig00026974
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00026974 (563 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270963.2| PREDICTED: pentatricopeptide repeat-containi... 109 5e-22 emb|CBI29222.3| unnamed protein product [Vitis vinifera] 109 5e-22 ref|XP_002303480.2| pentatricopeptide repeat-containing family p... 98 2e-18 ref|XP_006432869.1| hypothetical protein CICLE_v10000274mg [Citr... 94 2e-17 gb|EMJ18352.1| hypothetical protein PRUPE_ppa001463mg [Prunus pe... 89 1e-15 ref|XP_004249905.1| PREDICTED: pentatricopeptide repeat-containi... 86 8e-15 ref|XP_006351033.1| PREDICTED: pentatricopeptide repeat-containi... 85 1e-14 ref|XP_003548529.2| PREDICTED: pentatricopeptide repeat-containi... 82 7e-14 gb|EOY25407.1| Tetratricopeptide repeat-like superfamily protein... 75 9e-12 ref|XP_004149000.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 gb|AHB18408.1| pentatricopeptide repeat-containing protein [Goss... 71 2e-10 ref|XP_004509525.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 gb|ESW28323.1| hypothetical protein PHAVU_003G277400g [Phaseolus... 68 2e-09 ref|XP_002867936.1| hypothetical protein ARALYDRAFT_492917 [Arab... 66 5e-09 ref|XP_003628993.1| Pentatricopeptide repeat-containing protein ... 65 9e-09 sp|Q940A6.2|PP325_ARATH RecName: Full=Pentatricopeptide repeat-c... 63 4e-08 emb|CAA18631.1| putative protein [Arabidopsis thaliana] gi|72687... 63 4e-08 ref|NP_567587.1| pentatricopeptide repeat-containing protein [Ar... 63 4e-08 ref|XP_006413978.1| hypothetical protein EUTSA_v10024401mg [Eutr... 62 1e-07 ref|XP_006282558.1| hypothetical protein CARUB_v10004123mg [Caps... 61 2e-07 >ref|XP_002270963.2| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Vitis vinifera] Length = 1022 Score = 109 bits (272), Expect = 5e-22 Identities = 63/123 (51%), Positives = 78/123 (63%), Gaps = 4/123 (3%) Frame = -1 Query: 359 LFLPIKRPLT----VSPHPLQKLQNPRPEPLEVGPSNIEATPPAPAAFDQSFQYKKCVSS 192 +F PI RPLT +PHP P PL PS + P + D + K V+S Sbjct: 81 IFCPIARPLTCVTSAAPHP--------PSPL---PSQNQ-----PPSSDHALL--KSVTS 122 Query: 191 ILSCPNLNSCQCKDLLTHLTPHQFDSHFWEIHKYVDPSTALKFFYFACNSCGFRFTLRSY 12 ILS P+L+S QCK L+ HL+PHQFDS F+ + + V+P TAL FFYFA +SCGFRFTLRSY Sbjct: 123 ILSNPSLDSTQCKQLIPHLSPHQFDSVFFSVRRNVNPKTALNFFYFASDSCGFRFTLRSY 182 Query: 11 CVL 3 CVL Sbjct: 183 CVL 185 >emb|CBI29222.3| unnamed protein product [Vitis vinifera] Length = 826 Score = 109 bits (272), Expect = 5e-22 Identities = 63/123 (51%), Positives = 78/123 (63%), Gaps = 4/123 (3%) Frame = -1 Query: 359 LFLPIKRPLT----VSPHPLQKLQNPRPEPLEVGPSNIEATPPAPAAFDQSFQYKKCVSS 192 +F PI RPLT +PHP P PL PS + P + D + K V+S Sbjct: 14 IFCPIARPLTCVTSAAPHP--------PSPL---PSQNQ-----PPSSDHALL--KSVTS 55 Query: 191 ILSCPNLNSCQCKDLLTHLTPHQFDSHFWEIHKYVDPSTALKFFYFACNSCGFRFTLRSY 12 ILS P+L+S QCK L+ HL+PHQFDS F+ + + V+P TAL FFYFA +SCGFRFTLRSY Sbjct: 56 ILSNPSLDSTQCKQLIPHLSPHQFDSVFFSVRRNVNPKTALNFFYFASDSCGFRFTLRSY 115 Query: 11 CVL 3 CVL Sbjct: 116 CVL 118 >ref|XP_002303480.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550342907|gb|EEE78459.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 842 Score = 97.8 bits (242), Expect = 2e-18 Identities = 61/143 (42%), Positives = 77/143 (53%) Frame = -1 Query: 431 MDMRRLTVHKXXXXXXXXXXXXAVLFLPIKRPLTVSPHPLQKLQNPRPEPLEVGPSNIEA 252 MDMRRLT+ K P+KRPLT LQK P+ P + Sbjct: 5 MDMRRLTITKPIFIQS-----------PLKRPLTCITTTLQKQHQIHPQAPP--PPPLLQ 51 Query: 251 TPPAPAAFDQSFQYKKCVSSILSCPNLNSCQCKDLLTHLTPHQFDSHFWEIHKYVDPSTA 72 T P A +QS K VS ILS P+L+ +CK+L+ HL+P +FDS F + V+P TA Sbjct: 52 TQTNPQALNQSLL--KRVSLILSNPSLDCAKCKELVPHLSPQEFDSCFLALKSNVNPKTA 109 Query: 71 LKFFYFACNSCGFRFTLRSYCVL 3 L FF+F +C FRFT RSYCVL Sbjct: 110 LNFFHFVSETCKFRFTARSYCVL 132 >ref|XP_006432869.1| hypothetical protein CICLE_v10000274mg [Citrus clementina] gi|568835123|ref|XP_006471629.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X1 [Citrus sinensis] gi|568835125|ref|XP_006471630.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X2 [Citrus sinensis] gi|557534991|gb|ESR46109.1| hypothetical protein CICLE_v10000274mg [Citrus clementina] Length = 833 Score = 94.4 bits (233), Expect = 2e-17 Identities = 58/143 (40%), Positives = 80/143 (55%) Frame = -1 Query: 431 MDMRRLTVHKXXXXXXXXXXXXAVLFLPIKRPLTVSPHPLQKLQNPRPEPLEVGPSNIEA 252 MD+RRL++ K L + + RPLT Q+ Q E+ N + Sbjct: 1 MDLRRLSIPKPCS-----------LSIAVSRPLTHVTSTAQQQQ-------ELHNRNQQQ 42 Query: 251 TPPAPAAFDQSFQYKKCVSSILSCPNLNSCQCKDLLTHLTPHQFDSHFWEIHKYVDPSTA 72 PP P + +QS K VSS+LS +L+ +CK L +L+P +FD+ F+ I V+P TA Sbjct: 43 QPPPPQSSNQSLL--KWVSSVLSKQSLDPSKCKLFLPNLSPQEFDTLFFSIRSNVNPKTA 100 Query: 71 LKFFYFACNSCGFRFTLRSYCVL 3 LKFFYFA SC FRFT+RSYC+L Sbjct: 101 LKFFYFASQSCNFRFTVRSYCLL 123 >gb|EMJ18352.1| hypothetical protein PRUPE_ppa001463mg [Prunus persica] Length = 821 Score = 88.6 bits (218), Expect = 1e-15 Identities = 60/144 (41%), Positives = 78/144 (54%), Gaps = 1/144 (0%) Frame = -1 Query: 431 MDMRRLTVHKXXXXXXXXXXXXAVLFLPIKRPLTVSPHPLQKLQNP-RPEPLEVGPSNIE 255 MD+RRL++ K L I RPLT LQ+ + P +P PL+V Sbjct: 1 MDLRRLSISKP------------TLLFRINRPLTCVTCNLQRPKEPPQPPPLQV------ 42 Query: 254 ATPPAPAAFDQSFQYKKCVSSILSCPNLNSCQCKDLLTHLTPHQFDSHFWEIHKYVDPST 75 P P +QS VSSILS P+L+S +CK L+ L+ H+FD F I V+P T Sbjct: 43 --PKEPQPPNQSLH--NWVSSILSKPSLDSSKCKALIPLLSSHEFDRVFCSISSNVNPKT 98 Query: 74 ALKFFYFACNSCGFRFTLRSYCVL 3 AL FFYFA S F+FT+RS+CVL Sbjct: 99 ALHFFYFASESFKFQFTVRSFCVL 122 >ref|XP_004249905.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Solanum lycopersicum] Length = 839 Score = 85.5 bits (210), Expect = 8e-15 Identities = 58/148 (39%), Positives = 77/148 (52%), Gaps = 5/148 (3%) Frame = -1 Query: 431 MDMRRLTVHKXXXXXXXXXXXXAVLFLPIKRPLTVSPHPLQKLQNPRPEPLEVGPSNIEA 252 MD+RRL + K +F IKRPLT + Q EPL+ G SN Sbjct: 1 MDVRRLKIPKTI-----------AIFSHIKRPLTCVIYTASSDQIS--EPLQKGDSN--- 44 Query: 251 TPPAPAAFDQSFQ-----YKKCVSSILSCPNLNSCQCKDLLTHLTPHQFDSHFWEIHKYV 87 P P++ + + +K V S+LS P ++S + KDLLT L P QFD+ F EIH + Sbjct: 45 -KPNPSSEKKQIKGLDLNLRKWVVSVLSDPPVDSLKIKDLLTLLNPQQFDAIFLEIHSSL 103 Query: 86 DPSTALKFFYFACNSCGFRFTLRSYCVL 3 P LKFF+ A +C F FT+RSYC L Sbjct: 104 KPLNVLKFFHVASGTCSFSFTVRSYCTL 131 >ref|XP_006351033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Solanum tuberosum] Length = 928 Score = 84.7 bits (208), Expect = 1e-14 Identities = 57/154 (37%), Positives = 76/154 (49%), Gaps = 9/154 (5%) Frame = -1 Query: 437 IYMDMRRLTVHKXXXXXXXXXXXXAVLFLPIKRPLTVSPH---------PLQKLQNPRPE 285 I MD+RRL + K +F IKRPLT + PLQK Q+ +P Sbjct: 88 IRMDVRRLKIPKTI-----------AIFSHIKRPLTCVIYTASSDQISEPLQKAQSNKPN 136 Query: 284 PLEVGPSNIEATPPAPAAFDQSFQYKKCVSSILSCPNLNSCQCKDLLTHLTPHQFDSHFW 105 P + +K V S+LS P ++S + KDLLT LTP QFD+ F Sbjct: 137 P----------SSEKKQKNGLDLNLRKWVVSVLSNPPVDSLKIKDLLTLLTPQQFDAIFL 186 Query: 104 EIHKYVDPSTALKFFYFACNSCGFRFTLRSYCVL 3 EI+ + P LKFF+ A +CGF F++RSYC L Sbjct: 187 EIYSSLKPLNVLKFFHVASGTCGFSFSVRSYCTL 220 >ref|XP_003548529.2| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Glycine max] Length = 840 Score = 82.4 bits (202), Expect = 7e-14 Identities = 43/103 (41%), Positives = 58/103 (56%) Frame = -1 Query: 311 QKLQNPRPEPLEVGPSNIEATPPAPAAFDQSFQYKKCVSSILSCPNLNSCQCKDLLTHLT 132 ++L P P PL P + PP P+ + SIL+ L+S +CK +L HLT Sbjct: 36 RQLSPPPPPPLP--PPSPPPPPPHPSL--------SSIPSILTSKTLDSSKCKSILPHLT 85 Query: 131 PHQFDSHFWEIHKYVDPSTALKFFYFACNSCGFRFTLRSYCVL 3 PH FD F +H+ V+P T +FF FA C FRFT+RSYC+L Sbjct: 86 PHHFDRLFLSLHRTVNPKTTHEFFRFATRHCNFRFTVRSYCLL 128 >gb|EOY25407.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778152|gb|EOY25408.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778153|gb|EOY25409.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778154|gb|EOY25410.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778155|gb|EOY25411.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508778156|gb|EOY25412.1| Tetratricopeptide repeat-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 845 Score = 75.5 bits (184), Expect = 9e-12 Identities = 54/149 (36%), Positives = 76/149 (51%), Gaps = 6/149 (4%) Frame = -1 Query: 431 MDMRRLTVHKXXXXXXXXXXXXAVLFLPIKRPLT-----VSPHPLQKLQNPRPEPLEVGP 267 MD+RRL V+K ++ PI RPLT S + NP+ +P P Sbjct: 1 MDLRRLAVNKPIY-----------IYTPITRPLTCVTSTTSAAAAAQQFNPQQQPQP--P 47 Query: 266 SNIEATPPAPAAFDQSFQ-YKKCVSSILSCPNLNSCQCKDLLTHLTPHQFDSHFWEIHKY 90 N+ + + + + + Q +S ILS +L+S +CK LL L+P FD F I + Sbjct: 48 LNLTDSDSSNDSNNNNNQGLLGRLSCILSKSSLDSSKCKQLLPLLSPLDFDRFFSAISSH 107 Query: 89 VDPSTALKFFYFACNSCGFRFTLRSYCVL 3 ++P T L FFY A S FRFTLRSYC+L Sbjct: 108 LNPKTTLHFFYLASQSFNFRFTLRSYCIL 136 >ref|XP_004149000.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like [Cucumis sativus] Length = 822 Score = 73.6 bits (179), Expect = 3e-11 Identities = 36/66 (54%), Positives = 44/66 (66%) Frame = -1 Query: 200 VSSILSCPNLNSCQCKDLLTHLTPHQFDSHFWEIHKYVDPSTALKFFYFACNSCGFRFTL 21 VSS+LS +L+S +C LL HL+P QFD F+ I +P T L FFYFA NS FRFT+ Sbjct: 50 VSSVLSHSSLDSSKCSALLPHLSPSQFDQLFFSIGLKANPMTCLNFFYFASNSFKFRFTI 109 Query: 20 RSYCVL 3 SYC L Sbjct: 110 HSYCTL 115 >gb|AHB18408.1| pentatricopeptide repeat-containing protein [Gossypium hirsutum] Length = 846 Score = 71.2 bits (173), Expect = 2e-10 Identities = 47/121 (38%), Positives = 63/121 (52%), Gaps = 2/121 (1%) Frame = -1 Query: 359 LFLPIKRPLT--VSPHPLQKLQNPRPEPLEVGPSNIEATPPAPAAFDQSFQYKKCVSSIL 186 ++ PI RPLT S P+ P P ++ P + P +P +QS +SSIL Sbjct: 38 IYTPITRPLTCATSSSPI-----PSPAAPQIDP---QRQPSSPPPVNQSLL--DTLSSIL 87 Query: 185 SCPNLNSCQCKDLLTHLTPHQFDSHFWEIHKYVDPSTALKFFYFACNSCGFRFTLRSYCV 6 S P+L+S + K LL L+P FD F + DP T L FF+ A FRFTLRSY + Sbjct: 88 SKPSLDSSKSKQLLPLLSPSDFDRFFIALSPRADPKTTLNFFHLASRCFNFRFTLRSYYI 147 Query: 5 L 3 L Sbjct: 148 L 148 >ref|XP_004509525.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X1 [Cicer arietinum] gi|502153968|ref|XP_004509526.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X2 [Cicer arietinum] gi|502153970|ref|XP_004509527.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X3 [Cicer arietinum] gi|502153972|ref|XP_004509528.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X4 [Cicer arietinum] gi|502153974|ref|XP_004509529.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X5 [Cicer arietinum] gi|502153976|ref|XP_004509530.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X6 [Cicer arietinum] gi|502153978|ref|XP_004509531.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X7 [Cicer arietinum] gi|502153980|ref|XP_004509532.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X8 [Cicer arietinum] gi|502153982|ref|XP_004509533.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X9 [Cicer arietinum] gi|502153984|ref|XP_004509534.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19440, chloroplastic-like isoform X10 [Cicer arietinum] Length = 835 Score = 70.5 bits (171), Expect = 3e-10 Identities = 48/116 (41%), Positives = 59/116 (50%), Gaps = 3/116 (2%) Frame = -1 Query: 341 RPLT--VSPHPL-QKLQNPRPEPLEVGPSNIEATPPAPAAFDQSFQYKKCVSSILSCPNL 171 RPLT S P Q+ P P P P PP + + SILS L Sbjct: 21 RPLTWITSNTPRHQRRHFPPPPPPPPHPPPDSNKPPLTS-----------LPSILSHKIL 69 Query: 170 NSCQCKDLLTHLTPHQFDSHFWEIHKYVDPSTALKFFYFACNSCGFRFTLRSYCVL 3 +S +CK +L HLTPHQFD+ F+ H V+ T L FF FA N F FT+RSYC+L Sbjct: 70 DSSKCKSILPHLTPHQFDTLFFTHHSTVNLKTTLDFFRFASNQFKFCFTVRSYCLL 125 >gb|ESW28323.1| hypothetical protein PHAVU_003G277400g [Phaseolus vulgaris] Length = 837 Score = 67.8 bits (164), Expect = 2e-09 Identities = 43/114 (37%), Positives = 58/114 (50%), Gaps = 1/114 (0%) Frame = -1 Query: 341 RPLT-VSPHPLQKLQNPRPEPLEVGPSNIEATPPAPAAFDQSFQYKKCVSSILSCPNLNS 165 RPLT V+ L+ + P P P TPP + + S+L+ L+S Sbjct: 21 RPLTWVTSTALRHQRRHLPPPTPPPPPPPHPTPPQTT----NHALLTLLPSLLTTGVLDS 76 Query: 164 CQCKDLLTHLTPHQFDSHFWEIHKYVDPSTALKFFYFACNSCGFRFTLRSYCVL 3 +CK +L HL+P +FD F+ IH V+P T L FF A N F FT RSYC+L Sbjct: 77 SKCKSILPHLSPLEFDRLFFPIHHTVNPITTLDFFRLATNRFKFPFTFRSYCLL 130 >ref|XP_002867936.1| hypothetical protein ARALYDRAFT_492917 [Arabidopsis lyrata subsp. lyrata] gi|297313772|gb|EFH44195.1| hypothetical protein ARALYDRAFT_492917 [Arabidopsis lyrata subsp. lyrata] Length = 817 Score = 66.2 bits (160), Expect = 5e-09 Identities = 34/66 (51%), Positives = 45/66 (68%) Frame = -1 Query: 200 VSSILSCPNLNSCQCKDLLTHLTPHQFDSHFWEIHKYVDPSTALKFFYFACNSCGFRFTL 21 +SS+LS +L+ QCK L+T L+PH+FD F E V+P TAL FF A +S F F+L Sbjct: 56 LSSVLSKRSLDYEQCKQLITVLSPHEFDRLFPEFRFKVNPKTALDFFRLASDSFSFSFSL 115 Query: 20 RSYCVL 3 RSYC+L Sbjct: 116 RSYCLL 121 >ref|XP_003628993.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355523015|gb|AET03469.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 819 Score = 65.5 bits (158), Expect = 9e-09 Identities = 38/98 (38%), Positives = 53/98 (54%) Frame = -1 Query: 296 PRPEPLEVGPSNIEATPPAPAAFDQSFQYKKCVSSILSCPNLNSCQCKDLLTHLTPHQFD 117 P P+P P PP+P + SIL+ L+S +CK L+ +LTPH+F+ Sbjct: 33 PPPQPPPPPPQ-----PPSPPP--------TTLPSILAHKVLDSSKCKTLIPNLTPHEFE 79 Query: 116 SHFWEIHKYVDPSTALKFFYFACNSCGFRFTLRSYCVL 3 F+ H V+ T L FF FA + FRFT+RSYC+L Sbjct: 80 HSFFTHHTTVNLKTTLDFFSFASKNFKFRFTVRSYCIL 117 >sp|Q940A6.2|PP325_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g19440, chloroplastic; Flags: Precursor Length = 838 Score = 63.2 bits (152), Expect = 4e-08 Identities = 33/66 (50%), Positives = 44/66 (66%) Frame = -1 Query: 200 VSSILSCPNLNSCQCKDLLTHLTPHQFDSHFWEIHKYVDPSTALKFFYFACNSCGFRFTL 21 +SS+LS +L+ QCK L+T L+P +FD F E V+P TAL FF A +S F F+L Sbjct: 80 LSSVLSKRSLDYEQCKQLITVLSPLEFDRLFPEFRSKVNPKTALDFFRLASDSFSFSFSL 139 Query: 20 RSYCVL 3 RSYC+L Sbjct: 140 RSYCLL 145 >emb|CAA18631.1| putative protein [Arabidopsis thaliana] gi|7268739|emb|CAB78946.1| putative protein [Arabidopsis thaliana] Length = 814 Score = 63.2 bits (152), Expect = 4e-08 Identities = 33/66 (50%), Positives = 44/66 (66%) Frame = -1 Query: 200 VSSILSCPNLNSCQCKDLLTHLTPHQFDSHFWEIHKYVDPSTALKFFYFACNSCGFRFTL 21 +SS+LS +L+ QCK L+T L+P +FD F E V+P TAL FF A +S F F+L Sbjct: 56 LSSVLSKRSLDYEQCKQLITVLSPLEFDRLFPEFRSKVNPKTALDFFRLASDSFSFSFSL 115 Query: 20 RSYCVL 3 RSYC+L Sbjct: 116 RSYCLL 121 >ref|NP_567587.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|334186696|ref|NP_001190771.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|15810161|gb|AAL07224.1| unknown protein [Arabidopsis thaliana] gi|332658782|gb|AEE84182.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332658783|gb|AEE84183.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 825 Score = 63.2 bits (152), Expect = 4e-08 Identities = 33/66 (50%), Positives = 44/66 (66%) Frame = -1 Query: 200 VSSILSCPNLNSCQCKDLLTHLTPHQFDSHFWEIHKYVDPSTALKFFYFACNSCGFRFTL 21 +SS+LS +L+ QCK L+T L+P +FD F E V+P TAL FF A +S F F+L Sbjct: 67 LSSVLSKRSLDYEQCKQLITVLSPLEFDRLFPEFRSKVNPKTALDFFRLASDSFSFSFSL 126 Query: 20 RSYCVL 3 RSYC+L Sbjct: 127 RSYCLL 132 >ref|XP_006413978.1| hypothetical protein EUTSA_v10024401mg [Eutrema salsugineum] gi|557115148|gb|ESQ55431.1| hypothetical protein EUTSA_v10024401mg [Eutrema salsugineum] Length = 837 Score = 62.0 bits (149), Expect = 1e-07 Identities = 31/66 (46%), Positives = 43/66 (65%) Frame = -1 Query: 200 VSSILSCPNLNSCQCKDLLTHLTPHQFDSHFWEIHKYVDPSTALKFFYFACNSCGFRFTL 21 +S+ LS +L+ QCK L+ L+PH+FD F + V+P TAL FF A +S F F+L Sbjct: 77 LSAALSRRSLDYEQCKQLIATLSPHEFDRLFPDFRSKVNPKTALDFFRLASDSFSFSFSL 136 Query: 20 RSYCVL 3 RSYC+L Sbjct: 137 RSYCLL 142 >ref|XP_006282558.1| hypothetical protein CARUB_v10004123mg [Capsella rubella] gi|482551263|gb|EOA15456.1| hypothetical protein CARUB_v10004123mg [Capsella rubella] Length = 838 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/66 (48%), Positives = 43/66 (65%) Frame = -1 Query: 200 VSSILSCPNLNSCQCKDLLTHLTPHQFDSHFWEIHKYVDPSTALKFFYFACNSCGFRFTL 21 +SS+LS +L+ CK L+T L+P +FD F E V+P TAL FF A +S F F+L Sbjct: 77 LSSVLSKRSLDYELCKQLITVLSPLEFDRLFPEFRSKVNPKTALNFFRLASDSFSFSFSL 136 Query: 20 RSYCVL 3 RSYC+L Sbjct: 137 RSYCLL 142