BLASTX nr result
ID: Rehmannia22_contig00026666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00026666 (494 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB40749.1| starch branching enzyme II [Solanum tuberosum] 64 3e-08 ref|NP_001275467.1| 1,4-alpha-glucan-branching enzyme 2-2, chlor... 63 3e-08 emb|CAB40748.1| starch branching enzyme II [Solanum tuberosum] 61 1e-07 ref|XP_004246561.1| PREDICTED: 1,4-alpha-glucan-branching enzyme... 59 7e-07 emb|CAB40743.1| starch branching enzyme II [Solanum tuberosum] 59 7e-07 >emb|CAB40749.1| starch branching enzyme II [Solanum tuberosum] Length = 433 Score = 63.5 bits (153), Expect = 3e-08 Identities = 37/62 (59%), Positives = 45/62 (72%), Gaps = 1/62 (1%) Frame = +1 Query: 304 MVYTLPGVRLPTVPSAYKLSSNGWSSHVDTRNAHLSFFVKNKSNSRKIFSGK-PYESGSQ 480 MVYTL GVR PTVPS YK SNG+SS+ D RNA++S F+K S SRKI + K Y+S S+ Sbjct: 1 MVYTLSGVRFPTVPSVYK--SNGFSSNGDRRNANVSVFLKKHSLSRKILAEKSSYDSESR 58 Query: 481 SS 486 S Sbjct: 59 PS 60 >ref|NP_001275467.1| 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic-like [Solanum tuberosum] gi|4584509|emb|CAB40746.1| starch branching enzyme II [Solanum tuberosum] Length = 878 Score = 63.2 bits (152), Expect = 3e-08 Identities = 37/62 (59%), Positives = 44/62 (70%), Gaps = 1/62 (1%) Frame = +1 Query: 304 MVYTLPGVRLPTVPSAYKLSSNGWSSHVDTRNAHLSFFVKNKSNSRKIFSGK-PYESGSQ 480 MVYTL GVR PTVPS YK SNG+SS+ D RNA++S F+K S SRKI + K Y S S+ Sbjct: 1 MVYTLSGVRFPTVPSVYK--SNGFSSNGDRRNANISVFLKKHSLSRKILAEKSSYNSESR 58 Query: 481 SS 486 S Sbjct: 59 PS 60 >emb|CAB40748.1| starch branching enzyme II [Solanum tuberosum] Length = 882 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/52 (63%), Positives = 39/52 (75%) Frame = +1 Query: 304 MVYTLPGVRLPTVPSAYKLSSNGWSSHVDTRNAHLSFFVKNKSNSRKIFSGK 459 MVYTL GVR PTVPS YK SNG+SS+ D RNA++S F+K S SRKI + K Sbjct: 1 MVYTLSGVRFPTVPSVYK--SNGFSSNGDRRNANVSVFLKKHSLSRKILAEK 50 >ref|XP_004246561.1| PREDICTED: 1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic-like [Solanum lycopersicum] Length = 876 Score = 58.9 bits (141), Expect = 7e-07 Identities = 37/63 (58%), Positives = 45/63 (71%), Gaps = 2/63 (3%) Frame = +1 Query: 304 MVYTLPGVRLPTVPSAYKLSSNGW-SSHVDTRNAHLSFFVKNKSNSRKIFSGK-PYESGS 477 MVYTL GVR PTVPS YK SNG+ SS+ D RNA++S F+K S SRKI + K Y+S S Sbjct: 1 MVYTLSGVRFPTVPSVYK--SNGFTSSNGDRRNANVSVFLKKHSLSRKILAEKSSYDSES 58 Query: 478 QSS 486 + S Sbjct: 59 RPS 61 >emb|CAB40743.1| starch branching enzyme II [Solanum tuberosum] Length = 871 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = +1 Query: 304 MVYTLPGVRLPTVPSAYKLSSNGWSSHVDTRNAHLSFFVKNKSNSRKIFSGK 459 MVY L GVR PTVPS YK SNG+SS+ D RNA++S F+K S SRKI + K Sbjct: 1 MVYILSGVRFPTVPSVYK--SNGFSSNGDRRNANVSVFLKKHSLSRKILAEK 50