BLASTX nr result
ID: Rehmannia22_contig00026596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00026596 (497 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20835.3| unnamed protein product [Vitis vinifera] 65 7e-09 ref|XP_002283676.1| PREDICTED: monoglyceride lipase [Vitis vinif... 65 7e-09 gb|EXB93396.1| hypothetical protein L484_010724 [Morus notabilis] 62 8e-08 ref|XP_004291168.1| PREDICTED: monoglyceride lipase-like [Fragar... 61 2e-07 gb|EOY29778.1| Alpha/beta-Hydrolases superfamily protein [Theobr... 59 5e-07 ref|XP_006364726.1| PREDICTED: caffeoylshikimate esterase-like [... 59 7e-07 gb|EMJ24424.1| hypothetical protein PRUPE_ppa007225mg [Prunus pe... 58 1e-06 ref|XP_003522717.1| PREDICTED: caffeoylshikimate esterase-like [... 58 1e-06 gb|ESW09230.1| hypothetical protein PHAVU_009G110900g [Phaseolus... 57 3e-06 ref|XP_004245152.1| PREDICTED: monoglyceride lipase-like [Solanu... 57 3e-06 ref|XP_002516520.1| Monoglyceride lipase, putative [Ricinus comm... 57 3e-06 ref|XP_002309537.2| hypothetical protein POPTR_0006s25360g [Popu... 57 3e-06 gb|EPS59782.1| hypothetical protein M569_15023, partial [Genlise... 56 4e-06 ref|XP_003603637.1| Monoglyceride lipase [Medicago truncatula] g... 56 6e-06 ref|XP_004501143.1| PREDICTED: monoglyceride lipase-like [Cicer ... 55 7e-06 >emb|CBI20835.3| unnamed protein product [Vitis vinifera] Length = 304 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -3 Query: 495 GFLHDLLFEPEREEIAQDIIDWMEKRLTARYSENGMTYW 379 GFLHDLLFEPEREEIAQDIIDWMEKRL EN ++W Sbjct: 266 GFLHDLLFEPEREEIAQDIIDWMEKRLCGHDFENVHSHW 304 >ref|XP_002283676.1| PREDICTED: monoglyceride lipase [Vitis vinifera] gi|147865769|emb|CAN83251.1| hypothetical protein VITISV_034794 [Vitis vinifera] Length = 399 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -3 Query: 495 GFLHDLLFEPEREEIAQDIIDWMEKRLTARYSENGMTYW 379 GFLHDLLFEPEREEIAQDIIDWMEKRL EN ++W Sbjct: 361 GFLHDLLFEPEREEIAQDIIDWMEKRLCGHDFENVHSHW 399 >gb|EXB93396.1| hypothetical protein L484_010724 [Morus notabilis] Length = 387 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = -3 Query: 495 GFLHDLLFEPEREEIAQDIIDWMEKRLTARYSENGMTYW 379 GFLHDLLFEPER+EIAQDIIDWMEKRL ENG W Sbjct: 350 GFLHDLLFEPERKEIAQDIIDWMEKRLCGGL-ENGNNVW 387 >ref|XP_004291168.1| PREDICTED: monoglyceride lipase-like [Fragaria vesca subsp. vesca] Length = 386 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 495 GFLHDLLFEPEREEIAQDIIDWMEKRLTA 409 GFLHDLLFEPEREEIAQDIIDWMEKRL A Sbjct: 349 GFLHDLLFEPEREEIAQDIIDWMEKRLGA 377 >gb|EOY29778.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao] Length = 410 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -3 Query: 495 GFLHDLLFEPEREEIAQDIIDWMEKRLTA 409 GFLHDLLFEPEREEI QDIIDWMEKRL A Sbjct: 373 GFLHDLLFEPEREEIGQDIIDWMEKRLGA 401 >ref|XP_006364726.1| PREDICTED: caffeoylshikimate esterase-like [Solanum tuberosum] Length = 404 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 495 GFLHDLLFEPEREEIAQDIIDWMEKRLTARYSEN 394 GFLHDLLFEPEREEIAQDIIDWM K+L + EN Sbjct: 366 GFLHDLLFEPEREEIAQDIIDWMHKKLDSGNLEN 399 >gb|EMJ24424.1| hypothetical protein PRUPE_ppa007225mg [Prunus persica] Length = 377 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -3 Query: 495 GFLHDLLFEPEREEIAQDIIDWMEKRL 415 GFLHDLLFEPEREEIAQDII+WMEKRL Sbjct: 348 GFLHDLLFEPEREEIAQDIINWMEKRL 374 >ref|XP_003522717.1| PREDICTED: caffeoylshikimate esterase-like [Glycine max] Length = 378 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -3 Query: 495 GFLHDLLFEPEREEIAQDIIDWMEKRL 415 GFLHDLLFEPEREEIAQDII+WMEKRL Sbjct: 349 GFLHDLLFEPEREEIAQDIINWMEKRL 375 >gb|ESW09230.1| hypothetical protein PHAVU_009G110900g [Phaseolus vulgaris] Length = 379 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -3 Query: 495 GFLHDLLFEPEREEIAQDIIDWMEKRL 415 GFLHDLLFEPEREEIAQDII+WMEK+L Sbjct: 350 GFLHDLLFEPEREEIAQDIINWMEKKL 376 >ref|XP_004245152.1| PREDICTED: monoglyceride lipase-like [Solanum lycopersicum] Length = 404 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -3 Query: 495 GFLHDLLFEPEREEIAQDIIDWMEKRL 415 GFLHDLLFEPEREEIAQDIIDWM K+L Sbjct: 366 GFLHDLLFEPEREEIAQDIIDWMHKKL 392 >ref|XP_002516520.1| Monoglyceride lipase, putative [Ricinus communis] gi|223544340|gb|EEF45861.1| Monoglyceride lipase, putative [Ricinus communis] Length = 222 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -3 Query: 495 GFLHDLLFEPEREEIAQDIIDWMEKRLTA 409 GFLHDLLFEPEREEI QDII WMEKRL A Sbjct: 194 GFLHDLLFEPEREEIGQDIISWMEKRLGA 222 >ref|XP_002309537.2| hypothetical protein POPTR_0006s25360g [Populus trichocarpa] gi|550337060|gb|EEE93060.2| hypothetical protein POPTR_0006s25360g [Populus trichocarpa] Length = 388 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 495 GFLHDLLFEPEREEIAQDIIDWMEKRLTA 409 GFLHDLLFEPEREE+ QDII WMEKRL A Sbjct: 353 GFLHDLLFEPEREEVGQDIISWMEKRLGA 381 >gb|EPS59782.1| hypothetical protein M569_15023, partial [Genlisea aurea] Length = 192 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -3 Query: 495 GFLHDLLFEPEREEIAQDIIDWMEKR 418 G+LHDLLFEPEREEIAQDIIDWME+R Sbjct: 167 GYLHDLLFEPEREEIAQDIIDWMERR 192 >ref|XP_003603637.1| Monoglyceride lipase [Medicago truncatula] gi|355492685|gb|AES73888.1| Monoglyceride lipase [Medicago truncatula] Length = 407 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 495 GFLHDLLFEPEREEIAQDIIDWMEKRL 415 GFLHDLLFEPEREEIAQDII WME RL Sbjct: 377 GFLHDLLFEPEREEIAQDIISWMENRL 403 >ref|XP_004501143.1| PREDICTED: monoglyceride lipase-like [Cicer arietinum] Length = 380 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 495 GFLHDLLFEPEREEIAQDIIDWMEKRLTA 409 GFLHDLLFEPERE IAQDII+WMEK+L++ Sbjct: 350 GFLHDLLFEPEREAIAQDIINWMEKKLSS 378