BLASTX nr result
ID: Rehmannia22_contig00026527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00026527 (1321 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61876.1| hypothetical protein M569_12919, partial [Genlise... 63 2e-07 >gb|EPS61876.1| hypothetical protein M569_12919, partial [Genlisea aurea] Length = 265 Score = 63.2 bits (152), Expect = 2e-07 Identities = 28/42 (66%), Positives = 35/42 (83%), Gaps = 5/42 (11%) Frame = +2 Query: 1211 DDHKTPSVALMFQIGESATYHD-----KSPDMCNSTNCRGYE 1321 D HK+PSVALMFQ+GE+ATYH+ +SPD C+ST+CRGYE Sbjct: 117 DSHKSPSVALMFQVGENATYHNMGGCKQSPDTCSSTSCRGYE 158