BLASTX nr result
ID: Rehmannia22_contig00026241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00026241 (505 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tab... 82 6e-14 ref|XP_002308958.1| calcium-dependent protein kinase [Populus tr... 82 7e-14 gb|EXB52898.1| Calcium-dependent protein kinase 8 [Morus notabilis] 81 2e-13 gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] 80 4e-13 ref|XP_006351684.1| PREDICTED: calcium-dependent protein kinase ... 80 4e-13 ref|XP_004250931.1| PREDICTED: calcium-dependent protein kinase ... 80 4e-13 ref|XP_002283549.2| PREDICTED: calcium-dependent protein kinase ... 80 4e-13 ref|XP_002878160.1| calcium-dependent protein kinase 32 [Arabido... 80 4e-13 emb|CBI29862.3| unnamed protein product [Vitis vinifera] 80 4e-13 ref|XP_002513496.1| calcium-dependent protein kinase, putative [... 80 4e-13 ref|XP_002322709.1| calcium-dependent protein kinase [Populus tr... 80 4e-13 gb|ABO65099.1| calcium-dependent protein kinase 8, partial [Nico... 80 4e-13 dbj|BAE98496.1| calcium-dependent protein kinase [Arabidopsis th... 80 4e-13 emb|CAG27839.1| calcium-dependent protein kinase 8 [Nicotiana pl... 80 4e-13 ref|NP_191312.2| calcium-dependent protein kinase 32 [Arabidopsi... 80 4e-13 emb|CAB66110.1| calcium-dependent protein kinase [Arabidopsis th... 80 4e-13 ref|XP_006351224.1| PREDICTED: calcium-dependent protein kinase ... 79 5e-13 ref|XP_004249195.1| PREDICTED: calcium-dependent protein kinase ... 79 5e-13 gb|AAX07129.1| calcium-dependent protein kinase 4 [Capsicum annuum] 79 5e-13 ref|XP_006402868.1| hypothetical protein EUTSA_v10005884mg [Eutr... 79 6e-13 >gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tabacum] Length = 530 Score = 82.4 bits (202), Expect = 6e-14 Identities = 41/67 (61%), Positives = 43/67 (64%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP GRF EIV PYY AP VLKR Sbjct: 170 HKHGVMHRDLKPENFLFENKKETAPLKAIDFGLSVFFKPGGRFNEIVGSPYYMAPEVLKR 229 Query: 171 SYGQVMD 151 YG +D Sbjct: 230 DYGPEVD 236 >ref|XP_002308958.1| calcium-dependent protein kinase [Populus trichocarpa] gi|222854934|gb|EEE92481.1| calcium-dependent protein kinase [Populus trichocarpa] Length = 528 Score = 82.0 bits (201), Expect = 7e-14 Identities = 41/67 (61%), Positives = 44/67 (65%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 168 HEHGVMHRDLKPENFLFGNKKENAPLKAIDFGLSVFFKPGERFTEIVGSPYYMAPEVLKR 227 Query: 171 SYGQVMD 151 +YGQ +D Sbjct: 228 NYGQEVD 234 >gb|EXB52898.1| Calcium-dependent protein kinase 8 [Morus notabilis] Length = 530 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/67 (59%), Positives = 44/67 (65%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF +KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 169 HKHGVMHRDLKPENFLFGSKKETAPLKAIDFGLSVFFKPGERFTEIVGSPYYMAPEVLKR 228 Query: 171 SYGQVMD 151 +YG +D Sbjct: 229 NYGPEVD 235 >gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] Length = 579 Score = 79.7 bits (195), Expect = 4e-13 Identities = 41/70 (58%), Positives = 45/70 (64%) Frame = -2 Query: 360 ENRHTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSV 181 +N H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP V Sbjct: 169 QNCHEHGVMHRDLKPENFLFANKKENSPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEV 228 Query: 180 LKRSYGQVMD 151 LKR+YG +D Sbjct: 229 LKRNYGPEVD 238 >ref|XP_006351684.1| PREDICTED: calcium-dependent protein kinase 7-like [Solanum tuberosum] Length = 532 Score = 79.7 bits (195), Expect = 4e-13 Identities = 40/67 (59%), Positives = 43/67 (64%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 171 HMHGVMHRDLKPENFLFGNKKEAAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLKR 230 Query: 171 SYGQVMD 151 +YG +D Sbjct: 231 NYGPEVD 237 >ref|XP_004250931.1| PREDICTED: calcium-dependent protein kinase 7-like [Solanum lycopersicum] Length = 533 Score = 79.7 bits (195), Expect = 4e-13 Identities = 40/67 (59%), Positives = 43/67 (64%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 172 HMHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLKR 231 Query: 171 SYGQVMD 151 +YG +D Sbjct: 232 NYGPEVD 238 >ref|XP_002283549.2| PREDICTED: calcium-dependent protein kinase 32-like isoform 1 [Vitis vinifera] Length = 526 Score = 79.7 bits (195), Expect = 4e-13 Identities = 40/67 (59%), Positives = 43/67 (64%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 169 HKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFTEIVGSPYYMAPEVLKR 228 Query: 171 SYGQVMD 151 +YG +D Sbjct: 229 NYGPEVD 235 >ref|XP_002878160.1| calcium-dependent protein kinase 32 [Arabidopsis lyrata subsp. lyrata] gi|297323998|gb|EFH54419.1| calcium-dependent protein kinase 32 [Arabidopsis lyrata subsp. lyrata] Length = 538 Score = 79.7 bits (195), Expect = 4e-13 Identities = 40/67 (59%), Positives = 43/67 (64%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 179 HKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFDEIVGSPYYMAPEVLKR 238 Query: 171 SYGQVMD 151 +YG +D Sbjct: 239 NYGPEVD 245 >emb|CBI29862.3| unnamed protein product [Vitis vinifera] Length = 396 Score = 79.7 bits (195), Expect = 4e-13 Identities = 40/67 (59%), Positives = 43/67 (64%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 39 HKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFTEIVGSPYYMAPEVLKR 98 Query: 171 SYGQVMD 151 +YG +D Sbjct: 99 NYGPEVD 105 >ref|XP_002513496.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223547404|gb|EEF48899.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 536 Score = 79.7 bits (195), Expect = 4e-13 Identities = 40/67 (59%), Positives = 43/67 (64%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 179 HKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLKR 238 Query: 171 SYGQVMD 151 +YG +D Sbjct: 239 NYGPEVD 245 >ref|XP_002322709.1| calcium-dependent protein kinase [Populus trichocarpa] gi|222867339|gb|EEF04470.1| calcium-dependent protein kinase [Populus trichocarpa] Length = 532 Score = 79.7 bits (195), Expect = 4e-13 Identities = 40/67 (59%), Positives = 43/67 (64%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 172 HEHGVMHRDLKPENFLFGNKKENAPLKAIDFGLSVFFKPGERFTEIVGSPYYMAPEVLKR 231 Query: 171 SYGQVMD 151 +YG +D Sbjct: 232 NYGPEVD 238 >gb|ABO65099.1| calcium-dependent protein kinase 8, partial [Nicotiana attenuata] Length = 266 Score = 79.7 bits (195), Expect = 4e-13 Identities = 40/67 (59%), Positives = 43/67 (64%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 116 HRHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLKR 175 Query: 171 SYGQVMD 151 +YG +D Sbjct: 176 NYGPEVD 182 >dbj|BAE98496.1| calcium-dependent protein kinase [Arabidopsis thaliana] Length = 388 Score = 79.7 bits (195), Expect = 4e-13 Identities = 40/67 (59%), Positives = 43/67 (64%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 179 HKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLKR 238 Query: 171 SYGQVMD 151 +YG +D Sbjct: 239 NYGPEVD 245 >emb|CAG27839.1| calcium-dependent protein kinase 8 [Nicotiana plumbaginifolia] Length = 528 Score = 79.7 bits (195), Expect = 4e-13 Identities = 40/67 (59%), Positives = 43/67 (64%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 169 HRHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLKR 228 Query: 171 SYGQVMD 151 +YG +D Sbjct: 229 NYGPEVD 235 >ref|NP_191312.2| calcium-dependent protein kinase 32 [Arabidopsis thaliana] gi|75324322|sp|Q6NLQ6.1|CDPKW_ARATH RecName: Full=Calcium-dependent protein kinase 32 gi|44681392|gb|AAS47636.1| At3g57530 [Arabidopsis thaliana] gi|45773914|gb|AAS76761.1| At3g57530 [Arabidopsis thaliana] gi|332646147|gb|AEE79668.1| calcium-dependent protein kinase 32 [Arabidopsis thaliana] Length = 538 Score = 79.7 bits (195), Expect = 4e-13 Identities = 40/67 (59%), Positives = 43/67 (64%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 179 HKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLKR 238 Query: 171 SYGQVMD 151 +YG +D Sbjct: 239 NYGPEVD 245 >emb|CAB66110.1| calcium-dependent protein kinase [Arabidopsis thaliana] Length = 560 Score = 79.7 bits (195), Expect = 4e-13 Identities = 40/67 (59%), Positives = 43/67 (64%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 179 HKHGVMHRDLKPENFLFGNKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLKR 238 Query: 171 SYGQVMD 151 +YG +D Sbjct: 239 NYGPEVD 245 >ref|XP_006351224.1| PREDICTED: calcium-dependent protein kinase 32-like [Solanum tuberosum] Length = 524 Score = 79.3 bits (194), Expect = 5e-13 Identities = 40/67 (59%), Positives = 42/67 (62%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 169 HKHGVMHRDLKPENFLFENKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLKR 228 Query: 171 SYGQVMD 151 YG +D Sbjct: 229 DYGPEVD 235 >ref|XP_004249195.1| PREDICTED: calcium-dependent protein kinase 32-like [Solanum lycopersicum] Length = 525 Score = 79.3 bits (194), Expect = 5e-13 Identities = 40/67 (59%), Positives = 42/67 (62%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 170 HKHGVMHRDLKPENFLFENKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLKR 229 Query: 171 SYGQVMD 151 YG +D Sbjct: 230 DYGPEVD 236 >gb|AAX07129.1| calcium-dependent protein kinase 4 [Capsicum annuum] Length = 524 Score = 79.3 bits (194), Expect = 5e-13 Identities = 40/67 (59%), Positives = 42/67 (62%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 169 HKHGVMHRDLKPENFLFENKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLKR 228 Query: 171 SYGQVMD 151 YG +D Sbjct: 229 DYGPEVD 235 >ref|XP_006402868.1| hypothetical protein EUTSA_v10005884mg [Eutrema salsugineum] gi|557103967|gb|ESQ44321.1| hypothetical protein EUTSA_v10005884mg [Eutrema salsugineum] Length = 534 Score = 79.0 bits (193), Expect = 6e-13 Identities = 40/67 (59%), Positives = 43/67 (64%) Frame = -2 Query: 351 HTHEVMQHDLNLGEFLFNTKKEILPFKDIGFGLSIFFKPMGRFIEIVEIPYYTAPSVLKR 172 H H VM DL FLF KKE P K I FGLS+FFKP RF EIV PYY AP VLKR Sbjct: 175 HKHGVMHRDLKPENFLFANKKETAPLKAIDFGLSVFFKPGERFNEIVGSPYYMAPEVLKR 234 Query: 171 SYGQVMD 151 +YG +D Sbjct: 235 NYGPEVD 241