BLASTX nr result
ID: Rehmannia22_contig00025865
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00025865 (597 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71134.1| hypothetical protein M569_03628, partial [Genlise... 62 9e-08 ref|XP_003621938.1| hypothetical protein MTR_7g025230 [Medicago ... 60 6e-07 gb|AAD15368.1| putative retroelement pol polyprotein [Arabidopsi... 60 6e-07 gb|ABD32757.1| Integrase, catalytic region [Medicago truncatula] 57 3e-06 gb|AAF79879.1|AC000348_32 T7N9.5 [Arabidopsis thaliana] 57 5e-06 >gb|EPS71134.1| hypothetical protein M569_03628, partial [Genlisea aurea] Length = 217 Score = 62.4 bits (150), Expect = 9e-08 Identities = 31/65 (47%), Positives = 40/65 (61%) Frame = -2 Query: 206 DPLHLQGSDHPFA*VLTTHLQG*SAALVTNPLIGNNFLPWSRSVRISLGAKNKLGFIDGS 27 DPL+L GSDHP +A+LV+ L N+ W R VR++LGAKNKLG IDG Sbjct: 9 DPLYLSGSDHP------------NASLVSELLTTRNYFTWRRGVRLALGAKNKLGMIDGD 56 Query: 26 IDKPD 12 + KP+ Sbjct: 57 LPKPE 61 >ref|XP_003621938.1| hypothetical protein MTR_7g025230 [Medicago truncatula] gi|355496953|gb|AES78156.1| hypothetical protein MTR_7g025230 [Medicago truncatula] Length = 80 Score = 59.7 bits (143), Expect = 6e-07 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -2 Query: 146 QG*SAALVTNPLIGNNFLPWSRSVRISLGAKNKLGFIDGSIDKPDI 9 +G + LVT PL G N+L WSRS+R +LGAKNKL FIDGS+ PD+ Sbjct: 26 EGPNLVLVTPPLNGTNYLAWSRSMRCALGAKNKLPFIDGSLPVPDL 71 >gb|AAD15368.1| putative retroelement pol polyprotein [Arabidopsis thaliana] gi|17065314|gb|AAL32811.1| putative retroelement pol polyprotein [Arabidopsis thaliana] gi|21387147|gb|AAM47977.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 411 Score = 59.7 bits (143), Expect = 6e-07 Identities = 31/75 (41%), Positives = 44/75 (58%) Frame = -2 Query: 230 PPIVAREDDPLHLQGSDHPFA*VLTTHLQG*SAALVTNPLIGNNFLPWSRSVRISLGAKN 51 P + D+PL L SDHP ++V + L G+N+ WS ++RISL AKN Sbjct: 57 PKVPDNVDNPLILHSSDHP------------GLSIVAHVLDGSNYNSWSIAMRISLDAKN 104 Query: 50 KLGFIDGSIDKPDID 6 KLGF+DGS+ +P +D Sbjct: 105 KLGFVDGSLLRPSVD 119 >gb|ABD32757.1| Integrase, catalytic region [Medicago truncatula] Length = 1157 Score = 57.4 bits (137), Expect = 3e-06 Identities = 30/71 (42%), Positives = 42/71 (59%) Frame = -2 Query: 218 AREDDPLHLQGSDHPFA*VLTTHLQG*SAALVTNPLIGNNFLPWSRSVRISLGAKNKLGF 39 + D P ++ SD P S+ ++T L G+N+L W RS++ +LGAKNKL F Sbjct: 9 SNSDSPYYIHPSDGP------------SSLIITPKLNGSNYLAWHRSMQRALGAKNKLVF 56 Query: 38 IDGSIDKPDID 6 +DGSI PDID Sbjct: 57 LDGSISVPDID 67 >gb|AAF79879.1|AC000348_32 T7N9.5 [Arabidopsis thaliana] Length = 1436 Score = 56.6 bits (135), Expect = 5e-06 Identities = 29/68 (42%), Positives = 42/68 (61%) Frame = -2 Query: 209 DDPLHLQGSDHPFA*VLTTHLQG*SAALVTNPLIGNNFLPWSRSVRISLGAKNKLGFIDG 30 ++PL L SDHP ++V + L G+N+ WS ++RISL AKNKLGF+DG Sbjct: 55 ENPLLLHSSDHP------------GLSIVAHILDGSNYNSWSIAMRISLDAKNKLGFVDG 102 Query: 29 SIDKPDID 6 S+ +P +D Sbjct: 103 SLLRPSVD 110