BLASTX nr result
ID: Rehmannia22_contig00025841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00025841 (344 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS63595.1| hypothetical protein M569_11189, partial [Genlise... 60 4e-07 >gb|EPS63595.1| hypothetical protein M569_11189, partial [Genlisea aurea] Length = 265 Score = 59.7 bits (143), Expect = 4e-07 Identities = 34/53 (64%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = +1 Query: 187 MASRSP-PNPDLPRQPSTSTLNLHSDHSRGFESMNMDDILRNIYSDSESFALE 342 MASRS PN D PRQPS + SD RG SMN+DDILR+IYSDSES AL+ Sbjct: 5 MASRSSQPNQDAPRQPS-----MRSDAGRGLGSMNIDDILRSIYSDSESLALD 52