BLASTX nr result
ID: Rehmannia22_contig00025800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00025800 (304 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006469004.1| PREDICTED: uncharacterized protein LOC102629... 57 3e-06 ref|XP_006469003.1| PREDICTED: uncharacterized protein LOC102629... 57 3e-06 ref|XP_006446800.1| hypothetical protein CICLE_v10014575mg [Citr... 57 3e-06 >ref|XP_006469004.1| PREDICTED: uncharacterized protein LOC102629060 isoform X2 [Citrus sinensis] Length = 649 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 157 MDDKKLNFNQPLLSVRRYPPTAT-SRRSDQAKTDNSHPVIPRLPPHRSEL 303 M+DK+L+FNQPLLSVRR+ TA S + KTDNS P IP LP ++SEL Sbjct: 7 MEDKQLDFNQPLLSVRRFSSTAAPSEAQVKKKTDNSLPKIPPLPVYKSEL 56 >ref|XP_006469003.1| PREDICTED: uncharacterized protein LOC102629060 isoform X1 [Citrus sinensis] Length = 672 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 157 MDDKKLNFNQPLLSVRRYPPTAT-SRRSDQAKTDNSHPVIPRLPPHRSEL 303 M+DK+L+FNQPLLSVRR+ TA S + KTDNS P IP LP ++SEL Sbjct: 7 MEDKQLDFNQPLLSVRRFSSTAAPSEAQVKKKTDNSLPKIPPLPVYKSEL 56 >ref|XP_006446800.1| hypothetical protein CICLE_v10014575mg [Citrus clementina] gi|557549411|gb|ESR60040.1| hypothetical protein CICLE_v10014575mg [Citrus clementina] Length = 641 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 157 MDDKKLNFNQPLLSVRRYPPTAT-SRRSDQAKTDNSHPVIPRLPPHRSEL 303 M+DK+L+FNQPLLSVRR+ TA S + KTDNS P IP LP ++SEL Sbjct: 7 MEDKQLDFNQPLLSVRRFSSTAAPSEAQVKKKTDNSLPKIPPLPVYKSEL 56