BLASTX nr result
ID: Rehmannia22_contig00025636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00025636 (333 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP49326.1| glutathione S-transferase, partial [Olea europaea] 56 6e-06 >gb|AFP49326.1| glutathione S-transferase, partial [Olea europaea] Length = 55 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -3 Query: 331 KIKALFEARPHVSAWCNDILGRPAWQKVQASMK 233 KIK LF+ RPHVSAWC DILGRP+W+K+ A K Sbjct: 22 KIKGLFDERPHVSAWCADILGRPSWKKIVAMTK 54