BLASTX nr result
ID: Rehmannia22_contig00025547
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00025547 (427 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS62319.1| hypothetical protein M569_12471 [Genlisea aurea] 59 9e-07 >gb|EPS62319.1| hypothetical protein M569_12471 [Genlisea aurea] Length = 486 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/79 (40%), Positives = 44/79 (55%), Gaps = 3/79 (3%) Frame = -1 Query: 232 MKLRIVHQNQENRGGDXXXXXXXXXXXXXXXXMGV---SAEDEFVTEDFQPLNPSPISAY 62 MKL+IVHQNQE R G+ + S +D + F+PL P+P+S Sbjct: 1 MKLKIVHQNQETRPGEDHGIREFEPEMKKTEEEQILFSSGDDHVEQQIFEPLEPTPVSNP 60 Query: 61 DPLLVSGKRKRKPKEMVGE 5 D +L+SGKRKRKPK ++ E Sbjct: 61 DSVLLSGKRKRKPKWVIDE 79