BLASTX nr result
ID: Rehmannia22_contig00025041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00025041 (817 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW24235.1| hypothetical protein PHAVU_004G113400g [Phaseolus... 51 4e-06 >gb|ESW24235.1| hypothetical protein PHAVU_004G113400g [Phaseolus vulgaris] Length = 672 Score = 50.8 bits (120), Expect(2) = 4e-06 Identities = 27/63 (42%), Positives = 40/63 (63%) Frame = +1 Query: 370 QHFRPGDGNALPGNVPFSSVAAKEFLAQRWKEAISADHVKLVIS*NSWCEKSTASKASDI 549 +HF +G A PG+ FS AK FLA+RW+EAIS+DHV L ++ +S S ++ S Sbjct: 556 KHFSHPEGRAYPGSFQFSIQDAKAFLAKRWEEAISSDHVTLHLTSDSESSGSQETQDSIT 615 Query: 550 ESA 558 E++ Sbjct: 616 EAS 618 Score = 26.9 bits (58), Expect(2) = 4e-06 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +3 Query: 603 KREKSLKIQYIPKQK 647 K EK +KI+Y+PKQK Sbjct: 651 KSEKGIKIKYVPKQK 665