BLASTX nr result
ID: Rehmannia22_contig00024779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00024779 (359 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510473.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 ref|XP_002302003.1| forkhead-associated domain-containing family... 57 3e-06 ref|XP_004293189.1| PREDICTED: uncharacterized protein LOC101301... 56 4e-06 gb|EMJ26512.1| hypothetical protein PRUPE_ppa001183mg [Prunus pe... 56 6e-06 ref|XP_002306902.1| forkhead-associated domain-containing family... 55 7e-06 >ref|XP_002510473.1| conserved hypothetical protein [Ricinus communis] gi|223551174|gb|EEF52660.1| conserved hypothetical protein [Ricinus communis] Length = 776 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = +1 Query: 7 SIYVNGTEVATGQSLTLTSGCLIEVKGLAFVFEPNHTLVKQFGDG 141 SI VN E+A GQSL+LTS CLIE++G+ F+FE N VKQ+ DG Sbjct: 720 SISVNDKEMAPGQSLSLTSSCLIEIRGMPFIFETNQACVKQYLDG 764 >ref|XP_002302003.1| forkhead-associated domain-containing family protein [Populus trichocarpa] gi|222843729|gb|EEE81276.1| forkhead-associated domain-containing family protein [Populus trichocarpa] Length = 728 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +1 Query: 7 SIYVNGTEVATGQSLTLTSGCLIEVKGLAFVFEPNHTLVKQF 132 S+ VN E+A GQSL+LTSGCLIE++G+ F+FE N T VK + Sbjct: 672 SLSVNDKEIAPGQSLSLTSGCLIEIRGMPFIFEINQTCVKHY 713 >ref|XP_004293189.1| PREDICTED: uncharacterized protein LOC101301268 [Fragaria vesca subsp. vesca] Length = 890 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = +1 Query: 7 SIYVNGTEVATGQSLTLTSGCLIEVKGLAFVFEPNHTLVKQFGDGIAAGS 156 SI VN TE+ GQSL L+S CLIE++G+ F+FE N VKQ+ D I S Sbjct: 830 SISVNSTELTPGQSLRLSSSCLIEIRGMPFIFEVNEIRVKQYLDSITQAS 879 >gb|EMJ26512.1| hypothetical protein PRUPE_ppa001183mg [Prunus persica] Length = 886 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +1 Query: 7 SIYVNGTEVATGQSLTLTSGCLIEVKGLAFVFEPNHTLVKQFGDGI 144 SI VN EVA QSL+L+S CLIE++G+ F+FE N T VKQ+ D + Sbjct: 833 SISVNSKEVAPRQSLSLSSSCLIEIRGMPFIFETNQTRVKQYMDSV 878 >ref|XP_002306902.1| forkhead-associated domain-containing family protein [Populus trichocarpa] gi|222856351|gb|EEE93898.1| forkhead-associated domain-containing family protein [Populus trichocarpa] Length = 733 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = +1 Query: 7 SIYVNGTEVATGQSLTLTSGCLIEVKGLAFVFEPNHTLVKQF 132 S+ VN E+A G+SL+L+SGCLIE++G+ F+FE N T VKQ+ Sbjct: 680 SLSVNDKEIAPGRSLSLSSGCLIEIRGMPFIFEINQTCVKQY 721