BLASTX nr result
ID: Rehmannia22_contig00024498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00024498 (387 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59852.1| hypothetical protein M569_14952, partial [Genlise... 58 1e-06 ref|XP_006492859.1| PREDICTED: DNA polymerase delta small subuni... 55 1e-05 >gb|EPS59852.1| hypothetical protein M569_14952, partial [Genlisea aurea] Length = 311 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 9/52 (17%) Frame = +3 Query: 3 VAVDFRLAPEHRLPAQYED---------DQASDRANGDQWIRDHGDINTIIL 131 ++V++RLAPEHRLPAQY+D QA+D NG++WIRD+GD + L Sbjct: 105 ISVEYRLAPEHRLPAQYDDAIEAVHWLRQQAADEENGERWIRDYGDFSRCYL 156 >ref|XP_006492859.1| PREDICTED: DNA polymerase delta small subunit-like [Citrus sinensis] Length = 439 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 186 ECIIIGTLYKHMKLKPSILDEYSKE 260 ECIIIGTLYKHMKLKPSILDEYSKE Sbjct: 75 ECIIIGTLYKHMKLKPSILDEYSKE 99