BLASTX nr result
ID: Rehmannia22_contig00024426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00024426 (497 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519616.1| conserved hypothetical protein [Ricinus comm... 93 4e-17 >ref|XP_002519616.1| conserved hypothetical protein [Ricinus communis] gi|223541206|gb|EEF42761.1| conserved hypothetical protein [Ricinus communis] Length = 140 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/99 (43%), Positives = 66/99 (66%) Frame = +3 Query: 3 WRVVQPFQHRHVYDVDEMQDEEIHVDEFVSVENVVYQENDVNDTFEVSLGEIESLRRDDL 182 WRVVQ FQHRH+YDVDE+QDE + +++ VE+ VYQEN++ND V L EI SL R D+ Sbjct: 34 WRVVQLFQHRHIYDVDEIQDEAMDLNDLALVEDEVYQENEINDIVIVDLSEIASLNRVDI 93 Query: 183 DPEDIDESIIAKVPEVAEITSLXXXXXXXXXXXTMIEYC 299 D +D++ II+++ E ++ ++ T+++YC Sbjct: 94 DLKDVNSFIISELHEGSKDENIIDVDEFDETDDTLVDYC 132