BLASTX nr result
ID: Rehmannia22_contig00024318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia22_contig00024318 (400 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS66168.1| hypothetical protein M569_08605 [Genlisea aurea] 57 2e-06 >gb|EPS66168.1| hypothetical protein M569_08605 [Genlisea aurea] Length = 371 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 276 MSDDNASIKMVETENKGRALVSCRPLRAGEIVLKDSPILLY 398 MSD N I++V ENKGRA+VS R L+AGE++LK+SP+LLY Sbjct: 3 MSDGNELIRIVNIENKGRAIVSSRDLKAGEVILKESPLLLY 43